Recombinant Human Serine/Threonine-Protein Phosphatase 2A Activator (PTPA) Protein (His-SUMO&Myc)
Beta LifeScience
SKU/CAT #: BLC-08874P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Serine/Threonine-Protein Phosphatase 2A Activator (PTPA) Protein (His-SUMO&Myc)
Beta LifeScience
SKU/CAT #: BLC-08874P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Serine/Threonine-Protein Phosphatase 2A Activator (PTPA) Protein (His-SUMO&Myc) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | Q15257 |
| Target Symbol | PTPA |
| Synonyms | subunit B''; KIAA0044; MGC2184; Phosphotyrosyl phosphatase activator; PP2A; PP2A phosphatase activator; PP2A subunit B'; PP2A subunit B' isoform PR53; PP2A subunit B' PR53 isoform; PPP2R4; PR53; PR53 isoform; Protein phosphatase 2, regulatory subunit B-prime; Protein phosphatase 2A activator regulatory subunit 4; Protein phosphatase 2A regulatory subunit B' (PR 53); PTPA; PTPA_HUMAN; Serine/threonine protein phosphatase 2A regulatory subunit B'; Serine/threonine-protein phosphatase 2A activator; Serine/threonine-protein phosphatase 2A regulatory subunit 4; Serine/threonine-protein phosphatase 2A regulatory subunit B'' |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-10His-SUMO&C-Myc |
| Target Protein Sequence | AEGERQPPPDSSEEAPPATQNFIIPKKEIHTVPDMGKWKRSQAYADYIGFILTLNEGVKGKKLTFEYRVSEMWNEVHEEKEQAAKQSVSCDECIPLPRAGHCAPSEAIEKLVALLNTLDRWIDETPPVDQPSRFGNKAYRTWYAKLDEEAENLVATVVPTHLAAAVPEVAVYLKESVGNSTRIDYGTGHEAAFAAFLCCLCKIGVLRVDDQIAIVFKVFNRYLEVMRKLQKTYRMEPAGSQGVWGLDDFQFLPFIWGSSQLIDHPYLEPRHFVDEKAVNENHKDYMFLECILFITEMKTGPFAEHSNQLWNISAVPSWSKVNQGLIRMYKAECLEKFPVIQHFKFGSLLPIHPVTSG |
| Expression Range | 2-358aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 60.5kDa |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. Acts as a regulatory subunit for serine/threonine-protein phosphatase 2A (PP2A) modulating its activity or substrate specificity, probably by inducing a conformational change in the catalytic subunit, a proposed direct target of the PPIase. Can reactivate inactive phosphatase PP2A-phosphatase methylesterase complexes (PP2A(i)) in presence of ATP and Mg(2+). Reversibly stimulates the variable phosphotyrosyl phosphatase activity of PP2A core heterodimer PP2A(D) in presence of ATP and Mg(2+) (in vitro). The phosphotyrosyl phosphatase activity is dependent of an ATPase activity of the PP2A(D):PPP2R4 complex. Is involved in apoptosis; the function appears to be independent from PP2A. |
| Subcellular Location | Cytoplasm. Nucleus. |
| Protein Families | PTPA-type PPIase family |
| Database References | HGNC: 9308 OMIM: 600756 KEGG: hsa:5524 UniGene: PMID: 28300193 |
