Recombinant Human Serine/Arginine-Rich Splicing Factor 3 (SRSF3) Protein (His-GB1)
Beta LifeScience
SKU/CAT #: BLC-01649P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Serine/Arginine-Rich Splicing Factor 3 (SRSF3) Protein (His-GB1)
Beta LifeScience
SKU/CAT #: BLC-01649P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Serine/Arginine-Rich Splicing Factor 3 (SRSF3) Protein (His-GB1) is produced by our E.coli expression system. This is a protein fragment. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | P84103 |
| Target Symbol | SRSF3 |
| Synonyms | Pre-mRNA-splicing factor SRP20;Splicing factor, arginine/serine-rich 3 |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-6His-GB1 |
| Target Protein Sequence | MHRDSCPLDCKVYVGNLGNNGNKTELERAFGYYGPLRSVWVARNPPGFAFVEFEDPRDAADAVRELDGRTLCGCRVRVELSNGEKR |
| Expression Range | 1-86aa |
| Protein Length | partial |
| Mol. Weight | 17.9 kDa |
| Research Area | Epigenetics And Nuclear Signaling |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Splicing factor that specifically promotes exon-inclusion during alternative splicing. Interaction with YTHDC1, a RNA-binding protein that recognizes and binds N6-methyladenosine (m6A)-containing RNAs, promotes recruitment of SRSF3 to its mRNA-binding elements adjacent to m6A sites, leading to exon-inclusion during alternative splicing. Also functions as export adapter involved in mRNA nuclear export. Binds mRNA which is thought to be transferred to the NXF1-NXT1 heterodimer for export (TAP/NXF1 pathway); enhances NXF1-NXT1 RNA-binding activity. Involved in nuclear export of m6A-containing mRNAs via interaction with YTHDC1: interaction with YTHDC1 facilitates m6A-containing mRNA-binding to both SRSF3 and NXF1, promoting mRNA nuclear export. RNA-binding is semi-sequence specific. |
| Subcellular Location | Nucleus. Nucleus speckle. Cytoplasm. |
| Protein Families | Splicing factor SR family |
| Database References | HGNC: 10785 OMIM: 603364 KEGG: hsa:6428 STRING: 9606.ENSP00000362820 UniGene: PMID: 29857020 |
