Recombinant Human Serine/Arginine-Rich Splicing Factor 10 (SRSF10) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-10488P
Greater than 90% as determined by SDS-PAGE.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) SRSF10.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) SRSF10.
Recombinant Human Serine/Arginine-Rich Splicing Factor 10 (SRSF10) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-10488P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Serine/Arginine-Rich Splicing Factor 10 (SRSF10) Protein (His-SUMO) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | O75494 |
| Target Symbol | SRSF10 |
| Synonyms | 40 kDa SR repressor protein; 40 kDa SR-repressor protein; Anti TLS associated protein with SR repeats; arginine/serine-rich 13A; FUS interacting protein serine arginine rich 1; FUS interacting protein serine arginine rich 2; FUS interacting serine arginine rich protein 1; FUS-interacting serine-arginine-rich protein 1; FUSIP1; FUSIP2; NSSR; OTTHUMP00000015774; Serine arginine repressor protein 40 kDa; Serine/arginine-rich splicing factor 10; SFRS13; SFRS13A; Splicing factor; Splicing factor arginine serine rich 13; Splicing factor SRp38; SRp38; SRp40; SRrp40; SRS10_HUMAN; Srsf10; TASR; TASR1; TASR2; TLS associated protein TASR1; TLS associated protein TASR2; TLS associated protein with Ser Arg repeats; TLS associated protein with SR repeats; TLS associated serine arginine protein 1; TLS associated serine arginine protein 2; TLS associated serine arginine protein; TLS associated SR protein; TLS-associated protein with Ser-Arg repeats; TLS-associated protein with SR repeats; TLS-associated serine-arginine protein; TLS-associated SR protein |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-6His-SUMO |
| Target Protein Sequence | MSRYLRPPNTSLFVRNVADDTRSEDLRREFGRYGPIVDVYVPLDFYTRRPRGFAYVQFEDVRDAEDALHNLDRKWICGRQIEIQFAQGDRKTPNQMKAKEGRNVYSSSRYDDYDRYRRSRSRSYERRRSRSRSFDYNYRRSYSPRNSRPTGRPRRSRSHSDNDRPNCSWNTQYSSAYYTSRKI |
| Expression Range | 1-183aa |
| Protein Length | Full Length of Isoform 3 |
| Mol. Weight | 38.2kDa |
| Research Area | Epigenetics And Nuclear Signaling |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Splicing factor that in its dephosphorylated form acts as a general repressor of pre-mRNA splicing. Seems to interfere with the U1 snRNP 5'-splice recognition of SNRNP70. Required for splicing repression in M-phase cells and after heat shock. Also acts as a splicing factor that specifically promotes exon skipping during alternative splicing. Interaction with YTHDC1, a RNA-binding protein that recognizes and binds N6-methyladenosine (m6A)-containing RNAs, prevents SRSF10 from binding to its mRNA-binding sites close to m6A-containing regions, leading to inhibit exon skipping during alternative splicing. May be involved in regulation of alternative splicing in neurons, with isoform 1 acting as a positive and isoform 3 as a negative regulator. |
| Subcellular Location | Nucleus speckle. Cytoplasm. |
| Protein Families | Splicing factor SR family |
| Database References | HGNC: 16713 OMIM: 605221 KEGG: hsa:10772 STRING: 9606.ENSP00000420195 UniGene: PMID: 27851963 |
