Recombinant Human Serine/Arginine-Rich Splicing Factor 1 (SRSF1) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-04476P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Serine/Arginine-Rich Splicing Factor 1 (SRSF1) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-04476P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Serine/Arginine-Rich Splicing Factor 1 (SRSF1) Protein (His-SUMO) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | Q07955 |
| Target Symbol | SRSF1 |
| Synonyms | Alternative splicing factor 1; Alternative-splicing factor 1; arginine/serine-rich 1; ASF 1; ASF; ASF-1; ASF1; FLJ53078; MGC5228; P33 subunit; Pre mRNA splicing factor SF2 P33 subunit; pre-mRNA-splicing factor SF2; Serine/arginine-rich splicing factor 1; SF2; SF2P33; SFRS1; Splicing factor 2 alternate splicing factor; Splicing factor 2; Splicing factor; Splicing factor arginine/serine rich 1; SR Splicing factor 1; SRp30a; srsf1; SRSF1_HUMAN |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-6His-SUMO |
| Target Protein Sequence | SGGGVIRGPAGNNDCRIYVGNLPPDIRTKDIEDVFYKYGAIRDIDLKNRRGGPPFAFVEFEDPRDAEDAVYGRDGYDYDGYRLRVEFPRSGRGTGRGGGGGGGGGAPRGRYGPPSRRSENRVVVSGLPPSGSWQDLKDHMREAGDVCYADVYRDGTGVVEFVRKEDMTYAVRKLDNTKFRSHEGETAYIRVKVDGPRSPSYGRSRSRSRSRSRSRSRSNSRSRSYSPRRSRGSPRYSPRHSRSRSRT |
| Expression Range | 2-248aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 43.6kDa |
| Research Area | Transcription |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Plays a role in preventing exon skipping, ensuring the accuracy of splicing and regulating alternative splicing. Interacts with other spliceosomal components, via the RS domains, to form a bridge between the 5'- and 3'-splice site binding components, U1 snRNP and U2AF. Can stimulate binding of U1 snRNP to a 5'-splice site-containing pre-mRNA. Binds to purine-rich RNA sequences, either the octamer, 5'-RGAAGAAC-3' (r=A or G) or the decamers, AGGACAGAGC/AGGACGAAGC. Binds preferentially to the 5'-CGAGGCG-3' motif in vitro. Three copies of the octamer constitute a powerful splicing enhancer in vitro, the ASF/SF2 splicing enhancer (ASE) which can specifically activate ASE-dependent splicing. Isoform ASF-2 and isoform ASF-3 act as splicing repressors. May function as export adapter involved in mRNA nuclear export through the TAP/NXF1 pathway. |
| Subcellular Location | Cytoplasm. Nucleus speckle. |
| Protein Families | Splicing factor SR family |
| Database References | HGNC: 10780 OMIM: 600812 KEGG: hsa:6426 STRING: 9606.ENSP00000258962 UniGene: PMID: 28799539 |
