Recombinant Human Semenogelin-1 (SEMG1) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-02801P

Greater than 90% as determined by SDS-PAGE.
Recombinant Human Semenogelin-1 (SEMG1) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-02801P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Semenogelin-1 (SEMG1) Protein (His-SUMO) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | P04279 |
Target Symbol | SEMG1 |
Synonyms | Alpha-Inhibin-31; Alpha-Inhibin-92; Cancer/testis antigen 103; CT103; dJ172H20.2 (semenogelin I); dJ172H20.2; MGC14719; Semen coagulating protein; Semenogelin; Semenogelin I; SEMG; SEMG1; SEMG1_HUMAN; Seminal basic protein; seminal vesicle secretory protein 5; SgI; Svp-1; Svp5; SVPIIA; Svs2; SVS2P; Svs2p2; Svs5 |
Species | Homo sapiens (Human) |
Expression System | E.coli |
Tag | N-6His-SUMO |
Target Protein Sequence | QKGGSKGRLPSEFSQFPHGQKGQHYSGQKGKQQTESKGSFSIQYTYHVDANDHDQSRKSQQYDLNALHKTTKSQRHLGGSQQLLHNKQEGRDHDKSKGHFHRVVIHHKGGKAHRGTQNPSQDQGNSPSGKGISSQYSNTEERLWVHGLSKEQTSVSGAQKGRKQGGSQSSYVLQTEELVANKQQRETKNSHQNKGHYQNVVEVREEHSSKVQTSLCPAHQDKLQHGSKDIFSTQDELLVYNKNQHQTKNLNQDQQHGRKANKISYQSSSTEERRLHYGENGVQKDVSQRSIYSQTEKLVAGKSQIQAPNPKQEPWHGENAKGESGQSTNREQDLLSHEQKGRHQHGSHGGLDIVIIEQEDDSDRHLAQHLNNDRNPLFT |
Expression Range | 24-402aa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 58.8kDa |
Research Area | Cell Biology |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Predominant protein in semen. It participates in the formation of a gel matrix entrapping the accessory gland secretions and ejaculated spermatozoa. Fragments of semenogelin and/or fragments of the related proteins may contribute to the activation of progressive sperm movements as the gel-forming proteins are fragmented by KLK3/PSA.; Alpha-inhibin-92 and alpha-inhibin-31, derived from the proteolytic degradation of semenogelin, inhibit the secretion of pituitary follicle-stimulating hormone. |
Subcellular Location | Secreted. |
Protein Families | Semenogelin family |
Database References | |
Tissue Specificity | Seminal vesicle. |
Gene Functions References
- Data indicate that semenogelin I (Sg I) expression has potential value in predicting renal cell carcinoma (RCC) progression and prognosis, suggesting the use of Sg I as a biomarker for RCC. PMID: 25027395
- Peptides from the antimicrobial protein semenogelin I have antibacterial activity. PMID: 18314226
- EPPIN and SEMG1 rapidly co-evolved in primates PMID: 24312623
- SEMG1 was significantly changed in asthenozoosperm, which could be the candidate gene for the development of diagnostic marker and provided the opportunity to further illustrate the biological mechanisms of asthenozoospermia. PMID: 23289976
- Three regions of SEM1(86-107) comprise the amyloid fibril core that enhances HIV-1 infection. PMID: 24811874
- Interaction analysis identifies semenogelin I fragments as new binding partners of PIP in human seminal plasma PMID: 23085372
- EPPIN's semenogelin I binding site: a contraceptive drug target. PMID: 22699487
- Nuclear semenogelin I expression could be a reliable prognosticator in men who undergo radical prostatectomy. PMID: 22617231
- The proteomes of the type-1 diabetic, type-2 diabetic, and non-diabetic obese patients presented elevated amounts of the same set of one molecular form of semenogelin-1, one form of clusterin, and two forms of lactotransferrin. PMID: 21525168
- Peptides released by physiological cleavage of Semg1 and Semg2 form amyloids that enhance HIV infection. PMID: 22177559
- These results suggest the involvement of semenogelins in prostate cancer and their prognostic values in predicting cancer progression after radical prostatectomy. PMID: 21557275
- Spermatozoa interact with semenogelin I in solution in a non-Zn2+-dependent manner, but associate with immobilized semenogelin I only in the presence of Zn2+. PMID: 20378931
- Cysteine 239 of rSEMG1 appears to be the critical amino acid for both binding to eppin and inhibiting sperm motility. PMID: 19889947
- Transcripts in the gastro-intestinal tract and skeletal muscle almost exclusively encoded SgI PMID: 12200457
- Seminal plasma motility inhibitor, one of the fragments of Sg, has its inhibitory effect on ejaculated spermatozoa in liquefied semen under physiological conditions. PMID: 14581514
- peptides produced by cleavage of semenogelin I, the predominant human semen coagulum protein, had high levels of antibacterial activity. PMID: 14613901
- structural changes in the semenogelin 1 and 2 proteins that have arisen since the human-chimpanzee-gorilla split may be responsible for the physiological differences between these species ejaculated semen that correlate with their sociosexual behavior PMID: 14629036
- The binding of Zn2+ to SgI and SgII and their involvment in regulating the activity of PSA are reported. PMID: 15563730
- in seminal plasma and on spermatozoa following ejaculation, Eppin is bound to semenogelin I PMID: 15590901
- Authors analyzed an intronic T9 repeat of semenogelin I (SEMG1) and report mutation frequencies of 51% (75 of 146) and 62% (8 of 13) in MMR-deficient primary colorectal cancers and cell lines, respectively. PMID: 15930278
- The study provides evidence that senile seminal vesicle amyloid is derived from SgI; this form of amyloidosis was provisionally designated as ASgI. PMID: 15962837
- truncated (lacking 60 amino acids ) & wild-type semenogelin molecules had similar Zn(2+)-binding properties & they showed also similar susceptibility for degradation by prostate-specific antigen PMID: 16582407
- The semenogelin-CD52 soluble form is a direct consequence of the liquefaction process in human semen. PMID: 17624925
- The conformational change induced in semenogelin I by the binding of Zn(2+) may contribute to the ability of this protein to form a gel PMID: 17680810
- SGI is a novel target for protein S-nitrosylation in spermatozoa. PMID: 17683036
- SEMG I expression in myeloma cells can be upregulated by 5-azacytidine, IL-4 and IL-6. PMID: 18468680
- semenogelins I and II were directly cleaved by KLK14. Semenogelins were also able to reverse KLK14 inhibition by Zn2+, providing a novel regulatory mechanism for KLK14 activity. PMID: 18482984
- antibacterial activity of the semenogelin-derived peptides generated in seminal plasma was strictly zinc-dependent both at neutral and low pH PMID: 18714013
- Semenogelins (Sgs) modifies the membrane structure, indirectly inhibiting motility, and provides suggestions for a therapy for male infertility through selection of a functional sperm population using Sgs. PMID: 19089943
- expressed in 46% of patients with early stage chronic lymphocytic leukemia; potential target for cancer vaccines PMID: 19241194