Recombinant Human Secretogranin-1 (CHGB) Protein (His-GST)

Name: Recombinant Human Secretogranin-1 (CHGB) Protein (His-GST)
Brand: Beta LifeScience
SKU: BLC-01047P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Collections: High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Secretogranin-1 (CHGB) Protein (His-GST) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	P05060
Target Symbol	CHGB
Synonyms	(Chromogranin-B)(CgB)(Secretogranin I)(SgI)
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His-GST
Target Protein Sequence	HSTHYRASEEEPEYGEEIKGYPGVQAPEDLEWERYRGRGSEEYRAPRPQSEESWDEEDKRNYPSLELDKMAHGYGEESEEERGLEPGKGRHHRGRGGEPRAYFMSDTREEKRFLGEGHHRVQENQMDKARRHPQGAWKELDRNYLNYGEEGAPGKWQQQGDLQDTKENREEARFQDKQYSSHHTAEKRKRLGELFNPYYDPLQWKSSHFERRDNMNDNFLEGEEENELTLNEKNFFPEYNYDWWEKKPFSEDVNWGYEKRNLARVPKLDLKRQYDRVAQLDQLLHYRKKSAEFPDFYDSEEPVSTHQEAENEKDRADQTVLTEDEKKELENLAAMDLELQKIAEKFSQRG
Expression Range	328-677aa
Protein Length	Partial
Mol. Weight	73.5 kDa
Research Area	Neuroscience
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Secretogranin-1 is a neuroendocrine secretory granule protein, which may be the precursor for other biologically active peptides.
Subcellular Location	Secreted. Note=Neuroendocrine and endocrine secretory granules.
Protein Families	Chromogranin/secretogranin protein family
Database References	HGNC: 1930 OMIM: 118920 KEGG: hsa:1114 STRING: 9606.ENSP00000368244 UniGene: Hs.516874
Tissue Specificity	Expressed in the adrenal medulla, and in pheochromocytoma. Not expressed in liver.

Gene Functions References

evidence suggests that the P413L variant of chromogranin B is not associated with amyotrophic lateral sclerosis (ALS) risk or age at ALS onset (meta-analysis). PMID: 28795874
Data suggest that chromogranin B (CGB) is a promising emerging biomarker in heart failure (HF) patients with unique potential to integrate information from myocardial stress and neuro-endocrine activation. PMID: 29098879
Circulating chromogranin B (CgB) levels measured on Intensive Care Unit (ICU) admission provided additional prognostic information to established risk indices in acute respiratory failure (ARF) patients. PMID: 28049363
results presented here suggest that CHGB variant alleles, the rare CHGB-L413 and common CHGB-P413, may act as modifiers of ALS disease dependent on their expression levels which is higher in females because of a sex-determining region Y element in the CHGB gene promoter. PMID: 28175304
our results suggest that genetic variants of CHGB may have sex-specific effects on the risk of schizophrenia and provide useful preliminary information for further study. PMID: 28332369
intracellular calcium binding protein Sg1 is increased in early multiple sclerosis (MS) patients compared to relapsing-remitting MS and neurological controls. PMID: 26152395
The polymorphism P413L in the CHGB gene was not associated with sporadic amyotrophic lateral sclerosis in a group of Italian patients. PMID: 26003296
A heterogeneous response to short- and long-term physical activities among circulating granin proteins, particularly chromogranin B. PMID: 23816467
Results do not support the 413L variant of chromogranin B as a risk factor for sporadic amyotrophic lateral sclerosis in the French population. PMID: 20932227
common polymorphism in the 3'-UTR (C+84A) of CHGB, which disrupts an A/U-rich messenger ribonucleic acid stability element, associates with not only CHGB secretion but also excretion of isoprostane PMID: 20888525
The common CHGB promoter variants A-296C and A-261T, and their consequent haplotypes, alter binding of specific transcription factors to influence gene expression in cella as well as BP in vivo PMID: 20359597
Genetic variation at the CHGB locus, in the proximal promoter, influences CHGB expression as well as catecholamine secretion and later the early heritable responses to environmental stress, and resting/basal Blood Pressure in the population. PMID: 20011129
finding that CHGB may act as a susceptibility gene and modifier of onset in ALS is consistent with the emerging view that dysfunction of the secretory pathway may contribute to increased vulnerability of motor neurons PMID: 20007371
Chromogranin B was selected as a candidate gene for schizophrenia. We systematically screened all the promoter and exon regions of the gene and detected 15 single nucleotide polymorphisms in a Chinese population. PMID: 11959426
CgB may play some role in the early phase of neoplastic progression PMID: 12165659
there are four different types of chromogranin B in pancreatic islets as demonstrated by region-specific antibodies PMID: 12438147
5 CgB fragments were measured in plasma: CgB1-16, CgB312-331, CgB439-451, CgB568-577, & CgB647-657. Substantial heritability, as measured by h2r, was observed for 3 of the fragment concentrations, CgB312-331, CgB439-451, and CgB568-577. PMID: 15138309
10 microsatellite markers were analyzed, and an association of schizophrenia was found with D20S882 and D20S905 that flank D20S95. The chromogranin B gene is 30 kb from D20S905. PMID: 15219467
Overall, our results suggest that at least one locus in or close to the CHGB gene confers risk of the disorder and strengthen the evidence that CHGB is a promising susceptibility gene for schizophrenia in Chinese population. PMID: 17143778
Locally infused tyramine produced dose-dependent pressor responses, predicted by family history of hypertension, sex, and genetic variants at loci, particularly CHGB, that encode the biosynthesis, storage, and metabolism of catecholamines. PMID: 18180394
semiquantitative immunocytochemistry for chromogranin B in amyotrophic lateral sclerosis PMID: 18721831

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.