Recombinant Human Secreted Frizzled-Related Protein 2 (SFRP2) Protein (His-GST)

Beta LifeScience SKU/CAT #: BLC-07469P
Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SDS-PAGE.

Recombinant Human Secreted Frizzled-Related Protein 2 (SFRP2) Protein (His-GST)

Beta LifeScience SKU/CAT #: BLC-07469P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Human Secreted Frizzled-Related Protein 2 (SFRP2) Protein (His-GST) is produced by our E.coli expression system. This is a protein fragment.
Purity Greater than 90% as determined by SDS-PAGE.
Uniprotkb Q96HF1
Target Symbol SFRP2
Species Homo sapiens (Human)
Expression System E.coli
Tag N-6His-GST
Target Protein Sequence TMKEVLEQAGAWIPLVMKQCHPDTKKFLCSLFAPVCLDDLDETIQPCHSLCVQVKDRCAPVMSAFGFPWPDMLECDRFPQDNDLCIPLASSDHLLPATEEAPKVCEACKNKNDDDNDIM
Expression Range 68-186aa
Protein Length Partial
Mol. Weight 44.9 kDa
Research Area Cancer
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Soluble frizzled-related proteins (sFRPS) function as modulators of Wnt signaling through direct interaction with Wnts. They have a role in regulating cell growth and differentiation in specific cell types. SFRP2 may be important for eye retinal development and for myogenesis.
Subcellular Location Secreted.
Protein Families Secreted frizzled-related protein (sFRP) family
Database References

HGNC: 10777

OMIM: 604157

KEGG: hsa:6423

STRING: 9606.ENSP00000274063

UniGene: PMID: 30396168

  • Results show that SFRP2 and SFRP4 typically associate with a poor prognosis of cancer patients concomitant with the expression of genes associated with epithelial-to-mesenchymal transition. SFRP2 and 4 are likely derived from the tumor stroma, and thus tend to increase in tumors as compared to normal tissues. PMID: 28218291
  • The content of the methylated SFRP2 gene in endometrial tissue of patients with hyperplastic processes higher than 20-25% allows relate these women to the risk group of EC development and dictates the need of intensive observation of such patients. PMID: 29949535
  • Findings demonstrated that SFRP2 was downregulated in pituitary corticotroph adenomas. SFRP2 appears to act as a tumor suppressor in Cushing's disease by regulating the activity of the Wnt signaling pathway. PMID: 29620167
  • SFRP2 was down-regulated in the accelerated and blast phase of CML, whereas, the levels of WNT1, WNT3 and WNT5A were up-regulated in the accelerated and blast phase of CML. Overexpression SFRP2 inhibited proliferation, promoted apoptosis and activated the WNT pathway. PMID: 29704505
  • Methylation of SFRP2 gene may promote the invasiveness of non-small cell lung cancer cells through ZEB1 and MMP9 signaling. PMID: 29320940
  • the differences in SFRP2 promotor methylation observed between colorectal cancer (CRC)patients and healthy individuals by both assays were statistically significant (p<0.001). Our findings, although limited by the small sample size, do not support the use of the MSRH assay for CRC screening in stool. PMID: 28777432
  • augments Wnt3a-mediated beta-catenin signalling in dermal papilla cells, especially in beard dermal papilla cells PMID: 26914690
  • SFRP2 methylation is associated with colorectal cancer development. PMID: 26258809
  • TET1 potently inhibited canonical Wnt/beta-catenin signaling by demethylating and upregulating two upstream antagonists of this pathway, SFRP2 and DKK1, which was associated with inhibition of EMT and cancer cell metastasis. PMID: 28851501
  • SFRP2 could bind to locally present Wnt ligands and alter the balance of intracellular Wnt signaling to antagonize the canonical Wnt pathway in stem cells from the apical papilla. PMID: 28794794
  • SFRP2 induction is remarkable in tumor stroma, with transcription mainly modulated by the nuclear factor-kappaB (NF-kappaB) complex, a property shared by several effectors of the DNA damage secretory program. PMID: 26751775
  • down-regulated in ICU-acquired weakness and mice with inflammation-induced muscle atrophy; possibly establishes a positive feedback loop enhancing TGF-beta1-mediated atrophic effects in inflammation-induced atrophy PMID: 27661566
  • epigenetic silencing of Wnt antagonists was associated with gastric carcinogenesis, and concurrent hypermethylation of SFRP2 and DKK2 could be a potential marker for a prognosis of poor overall survival. PMID: 28152305
  • SFRP2 enhances the adipogenic and neurogenic differentiation potentials of stem cells from apical papilla by up-regulating SOX2 and OCT4. PMID: 28244619
  • SFRP2 is not only an agonist of Wnt pathway, but also a cancer promoting protein for lung cancer. PMID: 26323494
  • DKK1 (dickkopf-1) and SFRP2 (secreted frizzled-related protein 2) were the targets of miR-522 in hepatocellular carcinoma PMID: 26960688
  • the demethylation of SFRP2 gene appeared to inhibit nuclear retention of a key Wnt signaling factor, b-catenin, in osteosarcoma (OS) cell lines. Together, these data suggest that SFRP2 may function as an OS invasion suppressor by interfering with Wnt signaling, and the methylation of SFRP2 gene may promote pathogenesis of OS PMID: 26628297
  • SFRP2 hypermethylation is associated with colorectal cancer. PMID: 27221916
  • Silencing KDM2A, a histone demethylase and BCL6 co-repressor, de-repressed SFRP2 transcription by increasing histone H3K4 and H3K36 methylation at the SFRP2 promoter. PMID: 27074224
  • SFRP2 protein plays a role in the ultraviolet rays induced hyperpigmentary disorders. PMID: 26763443
  • age-related increases in sFRP2 augment both angiogenesis and metastasis of melanoma cells PMID: 27042933
  • Patients with Cytogenetically Normal Primary Acute Myeloid Leukemia and high sFRP2 expression had higher incidence of complete remission rate and better overall survival. PMID: 26517501
  • A combination of GATA5 and SFRP2 methylation could be promising as a marker for the detection and diagnosis of colorectal cancers and adenomas. PMID: 25759530
  • The distribution of Sfrp2 (and Sfrp1) in the eye is consistent with the idea that they modulate visual pathfinding and axon guidance. PMID: 25788689
  • These findings suggest that decreased SFRP2 expression is associated with intermediate/poor karyotypes in acute myeloid leukemia PMID: 25197341
  • The role of SFRP2, as a functional tumor suppressor in the development of oral squamous cell carcinoma, is mediated through inhibition of the Wnt signaling pathway. PMID: 25189527
  • Data suggest that overexpression of secreted frizzled-related protein 2 (sFRP2) gene in mesenchymal stem cells (hMSCs) might improve the therapeutic effectiveness of hMSC transplantation. PMID: 25245632
  • Aberrant methylation of APC gene was statistically significant associated with age over 50, DDK3 with male, SFRP4, WIF1, and WNT5a with increasing tumor stage SFRP4 and WIF1 with tumor differentiation and SFRP2 and SFRP5 with histological type PMID: 25107489
  • In hepatitis C virus infected liver tissues hypermethylation at promoter regions of key cancer related genes SFRP2 and DKK1, appears early at chronic hepatitis and liver cirrhosis stages, long before the appearance of hepatocellular carcinoma. PMID: 24947038
  • High SFRP2 gene methylation is associated with ovarian cancer infected with high risk human papillomavirus. PMID: 24761891
  • The risk size of SFRP2 hypermethylation from normal control to adenoma or polyp as well as from adenoma or polyp to colorectal cancer increased gradually PMID: 25053594
  • results show that sFRP-2 is a target gene of hypermethylation in esophageal Basaloid squamous cell carcinoma PMID: 24464051
  • SFRP2 appears to interact with Slug to affect the apoptosis of hypertrophic scar fibroblasts PMID: 23226515
  • show that SFRP2 hypermethylation is a common event in prostate cancer. SFRP2 methylation in combination with other epigenetic markers may be a useful biomarker of prostate cancer PMID: 22915211
  • Promoter hypermethylation of tumor suppressor SFRP2 is associated with prostate carcinoma. PMID: 22136354
  • Recombinant sFRP2 enhanced Wnt3a-dependent phosphorylation of LRP6 as well as both cytosolic beta-catenin levels and its nuclear translocation. sFRP2 enhanced the Wnt3a-mediated transcription of several genes including DKK1 and NKD1. PMID: 20723538
  • Data suggest that silencing of secreted frizzled-related protein 2 expression through promoter hypermethylation may be a factor in ESCC carcinogenesis through loss of its tumor-suppressive activity. PMID: 22363119
  • there is a loss of SFRP-2 expression from benign to malignant prostate glands and differential SFRP-2 expression among two possible subgroups of Gleason grade 5 tumours PMID: 22175903
  • Hypermethylation of SFRP2 gene is associated with advanced gastric cancer. PMID: 21409489
  • SFRP2 may play an important role in the development of earlobe keloid, especially at the keloid edge. PMID: 21174795
  • A study evaluating the pattern of SFRP2 methylation throughout the promoter during progressive tumorigenesis. PMID: 21709714
  • Among the extracellular regulators that suppress the Wnt pathway, secreted frizzled-related protein 2 (SFRP2), was up-regulated 4.3-fold in healthy smokers and 4.9-fold in COPD smokers. PMID: 21490961
  • serum SFRP2 methylation status represents a promising, non-invasive marker for colorectal carcinoma detection and staging PMID: 21463549
  • Combined effects of epigenetic alterations in SFRP2 and point mutations in K-ras protein play a role in development of mucinous type anal adenocarcinoma. PMID: 20686305
  • Promoter hypermethylation of SFRP2 is associated with Acute myeloid leukemia. PMID: 20795789
  • SFRP2 promoter methylation is aberrant in mesothelioma. PMID: 20596629
  • induces transient rise of intracellular Ca2+ via emptying of intracellular calcium stores in neutrophils PMID: 20602801
  • These results support sFRP2's role as an enhancer of Wnt3A/beta-catenin signaling, a result with biological impact for both normal development and diverse pathologies such as tumorigenesis. PMID: 20723538
  • This is the first report documenting that sFRP2 activates the canonical Wnt pathway and promotes cell growth by evoking diverse signaling cascades in renal cancer cells. PMID: 20501806
  • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    Recently viewed