Recombinant Human Sars Coronavirus Spike Glycoprotein (S) Protein (His&Myc), Active
Beta LifeScience
SKU/CAT #: BLC-05860P
Greater than 95% as determined by SDS-PAGE.
Activity Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV S-RBD at 2 μg/ml can bind Paguma larvata ACE2 , the EC 50 is 5.056-7.559 ng/ml. Biological Activity Assay
Activity Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV S-RBD at 5 μg/ml can bind human ACE2 , the EC 50 is 7.941-10.49 ng/ml. Biological Activity Assay
Recombinant Human Sars Coronavirus Spike Glycoprotein (S) Protein (His&Myc), Active
Beta LifeScience
SKU/CAT #: BLC-05860P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Sars Coronavirus Spike Glycoprotein (S) Protein (His&Myc), Active is produced by our Mammalian cell expression system. This is a protein fragment. |
Purity | Greater than 95% as determined by SDS-PAGE. |
Endotoxin | Less than 1.0 EU/ug as determined by LAL method. |
Activity | 1. Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV S-RBD at 2 μg/ml can bind Paguma larvata ACE2 , the EC 50 is 5.056-7.559 ng/ml. 2. Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV S-RBD at 5 μg/ml can bind human ACE2 , the EC 50 is 7.941-10.49 ng/ml. |
Uniprotkb | P59594 |
Target Symbol | S |
Synonyms | (S glycoprotein)(E2)(Peplomer protein)(Spike protein S1)(Spike protein S2) |
Species | Human SARS coronavirus (SARS-CoV) (Severe acute respiratory syndrome coronavirus) |
Expression System | Mammalian cell |
Tag | N-10His&C-Myc |
Target Protein Sequence | RVVPSGDVVRFPNITNLCPFGEVFNATKFPSVYAWERKKISNCVADYSVLYNSTFFSTFKCYGVSATKLNDLCFSNVYADSFVVKGDDVRQIAPGQTGVIADYNYKLPDDFMGCVLAWNTRNIDATSTGNYNYKYRYLRHGKLRPFERDISNVPFSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQPYRVVVLSFELLNAPATVCGPKLSTDLIKNQCVNF |
Expression Range | 306-527aa |
Protein Length | Partial |
Mol. Weight | 30.0 kDa |
Research Area | Microbiology |
Form | Lyophilized powder |
Buffer | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | May down-regulate host tetherin (BST2) by lysosomal degradation, thereby counteracting its antiviral activity.; attaches the virion to the cell membrane by interacting with host receptor, initiating the infection. Binding to human ACE2 and CLEC4M/DC-SIGNR receptors and internalization of the virus into the endosomes of the host cell induces conformational changes in the S glycoprotein. Proteolysis by cathepsin CTSL may unmask the fusion peptide of S2 and activate membranes fusion within endosomes.; mediates fusion of the virion and cellular membranes by acting as a class I viral fusion protein. Under the current model, the protein has at least three conformational states: pre-fusion native state, pre-hairpin intermediate state, and post-fusion hairpin state. During viral and target cell membrane fusion, the coiled coil regions (heptad repeats) assume a trimer-of-hairpins structure, positioning the fusion peptide in close proximity to the C-terminal region of the ectodomain. The formation of this structure appears to drive apposition and subsequent fusion of viral and target cell membranes.; Acts as a viral fusion peptide which is unmasked following S2 cleavage occurring upon virus endocytosis. |
Subcellular Location | Virion membrane; Single-pass type I membrane protein. Host endoplasmic reticulum-Golgi intermediate compartment membrane; Single-pass type I membrane protein. Host cell membrane; Single-pass type I membrane protein. |
Protein Families | Betacoronaviruses spike protein family |