Recombinant Human Sal-Like Protein 4 (SALL4) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-00074P
Greater than 85% as determined by SDS-PAGE.
Recombinant Human Sal-Like Protein 4 (SALL4) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-00074P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Sal-Like Protein 4 (SALL4) Protein (His&Myc) is produced by our Baculovirus expression system. This is a protein fragment. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Uniprotkb | Q9UJQ4 |
| Target Symbol | SALL4 |
| Synonyms | AA407717; AL022809; AW536104; C330011P20Rik; C78083; C78563; dJ1112F19.1; DRRS; HSAL4; Sal like 4 (Drosophila); Sal like 4; Sal like Protein 4; Sal-like protein 4; Sall4; SALL4_HUMAN; Spalt like transcription factor 4; Tex20; Zinc finger protein 797; Zinc finger protein SALL4; ZNF797 |
| Species | Homo sapiens (Human) |
| Expression System | Baculovirus |
| Tag | N-10His&C-Myc |
| Target Protein Sequence | PKEILAPSVNVDPVVWNQYTSMLNGGLAVKTNEISVIQSGGVPTLPVSLGATSVVNNATVSKMDGSQSGISADVEKPSATDGVPKHQFPHFLEENKIAVS |
| Expression Range | 954-1053aa+11R |
| Protein Length | Partial |
| Mol. Weight | 16 |
| Research Area | Developmental Biology |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Transcription factor with a key role in the maintenance and self-renewal of embryonic and hematopoietic stem cells. |
| Subcellular Location | Cytoplasm. Nucleus. |
| Protein Families | Sal C2H2-type zinc-finger protein family |
| Database References | HGNC: 15924 OMIM: 147750 KEGG: hsa:57167 STRING: 9606.ENSP00000217086 UniGene: PMID: 29593314 |
