Recombinant Human Saitohin (STH) Protein (His-SUMO)

Name: Recombinant Human Saitohin (STH) Protein (His-SUMO)
Brand: Beta LifeScience
SKU: BLC-10166P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Product Overview

Description	Recombinant Human Saitohin (STH) Protein (His-SUMO) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	Q8IWL8
Target Symbol	STH
Synonyms	STH; Saitohin
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His-SUMO
Target Protein Sequence	MSEGGGQVSCIFAAPTRLCRWPALIECGVNLTQPLCEWMIQVARDRTLSLAWEVASLLTLSSSEVGLEGVGTIWPSSYSSEESSRNGAEQGRQLSIEGPFQGQNCPSHPAAALPLPMRGESQATSCQV
Expression Range	1-128aa
Protein Length	Full Length
Mol. Weight	29.7kDa
Research Area	Neuroscience
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Subcellular Location	Cytoplasm. Nucleus.
Database References	HGNC: 18839 OMIM: 607067 KEGG: hsa:246744 STRING: 9606.ENSP00000443168 UniGene: Hs.661831
Tissue Specificity	Highest expression in placenta, muscle, fetal brain, and adult brain, with lower expression in heart, kidney, stomach, testis, and adrenal gland. In the central nervous system, highest expression is in temporal lobe, hypothalamus, medulla and spinal cord,

Gene Functions References

Saitohin Q7R polymorphism is associated with late-onset Alzheimer's disease susceptibility among caucasian populations. (Meta-analysis) PMID: 28211174
Results showed a significant interaction effect of COMT and STH polymorphisms on cognitive performances, strengthening the involvement of STH in cognitive impairments, especially in the domains commonly impaired in schizophrenia PMID: 25283873
The rs6203857 polymorphism of the saitohin gene is a genetic risk factor for Parkinson's disease. PMID: 25168738
results of this meta-analysis suggested that MAPT_238bp/STH Q7R polymorphisms might modulate the risk of Parkinson's disease susceptibility PMID: 25305495
These results suggest a possible contribution of STH gene products on the heterogeneity of core frontal executive functions deterioration in schizophrenia PMID: 22187337
Single polymorphisms within the saitohin gene were associated with increased cognitive impairment and functional dependence persons with moderate-to-advanced Alzheimer disease. PMID: 21934306
effect of Saitohin on Abl-mediated phosphorylation appears to be allele-specific, providing evidence for a new cellular function for STH PMID: 21769920
STH polymorphisms play a possibly shared role with those of serotinin transporter 5-HTTLPR gene as a susceptibility factor for Alzheimer's disease and frontotemperal lobar dementia. PMID: 20852909
Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator) PMID: 20852909
a gene within an intron of the tau gene; Q7R polymorphism appears to be over-represented in the homozygous state in late onset Alzheimer's disease subjects PMID: 12032355
The saitohin Q allele, a novel determinant of tau H1 haplotypes, may represent a causative factor involved in the determinism of several tauopathies, e.g., frontotemporal dementia. PMID: 12447938
At the STH gene only a common polymorphic change was found. PMID: 12826737
Increased risk of Alzheimer's disease associated with the STH RR genotype is limited to late-onset Alzheimer's disease. PMID: 12826738
The R allele of STH is associated with the H2 haplotype of tau; no correlation is found between R allele frequency and Alzheimer's or Parkinson's disease. PMID: 12932819
Saitohin interacts with peroxiredoxin 6, a unique member of that family that is bifunctional and the levels of which increase in Pick disease. PMID: 16186110
We found no evidence that could support a major pathogenic role of STH and TAU haplotype in AD, FTD or PD. PMID: 16909000
Q allele of STH gene is over-represented in a tested group of patients with Huntington disease and might be considered a risk factor for HD like diseases. PMID: 18300012
Homozygous Q/Q of STH Q7R polymorphism was the only one genotype found in either LOAD group or controls. No R allele was detected in LOAD and control groups. PMID: 18396294
The Saitohin Q7R polymorphism is unlikely to contribute significantly to Alzheimer's disease susceptibility of the Han population in south China. PMID: 18850062
Observational study of gene-disease association. (HuGE Navigator) PMID: 18850062
Observational study of gene-disease association. (HuGE Navigator) PMID: 18509094
Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator) PMID: 18396294
Observational study of genotype prevalence. (HuGE Navigator) PMID: 18300012
Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator) PMID: 18307033
Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator) PMID: 15136700
Observational study of gene-disease association. (HuGE Navigator) PMID: 16603077
Observational study of gene-disease association. (HuGE Navigator) PMID: 16909000

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.