Recombinant Human S-Phase Kinase-Associated Protein 1 (SKP1) Protein (GST)

Beta LifeScience SKU/CAT #: BLC-04250P
Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SDS-PAGE.

Recombinant Human S-Phase Kinase-Associated Protein 1 (SKP1) Protein (GST)

Beta LifeScience SKU/CAT #: BLC-04250P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Human S-Phase Kinase-Associated Protein 1 (SKP1) Protein (GST) is produced by our E.coli expression system. This is a full length protein.
Purity Greater than 90% as determined by SDS-PAGE.
Uniprotkb P63208
Target Symbol SKP1
Synonyms Cyclin A/CDK2 associated p19; Cyclin A/CDK2 associated protein p19; Cyclin-A/CDK2-associated protein p19; EMC19; MGC34403; OCP 2; OCP II; OCP II protein; OCP-2; OCP-II; OCP2; OCPII; Organ of Corti protein 2; Organ of Corti protein II; OTTHUMP00000159379; OTTHUMP00000159380; OTTHUMP00000228275; OTTHUMP00000228276; OTTHUMP00000228278; OTTHUMP00000228279; OTTHUMP00000228281; p19A; p19skp1; RNA polymerase II elongation factor like protein; RNA polymerase II elongation factor like protein OCP2; RNA polymerase II elongation factor-like protein; S phase kinase associated protein 1; S phase kinase associated protein 1A; S phase kinase associated protein 1A p19A; S-phase kinase-associated protein 1; SIII; Skp 1; SKP 1A; skp1; SKP1_HUMAN; SKP1A; TCEB1L; Transcription Elongation Factor B 1 like; Transcription elongation factor B; Transcription elongation factor B SIII polypeptide 1 like
Species Homo sapiens (Human)
Expression System E.coli
Tag C-GST
Target Protein Sequence PSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK
Expression Range 2-163aa
Protein Length Full Length of Mature Protein
Mol. Weight 45.5kDa
Research Area Cell Biology
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Essential component of the SCF (SKP1-CUL1-F-box protein) ubiquitin ligase complex, which mediates the ubiquitination of proteins involved in cell cycle progression, signal transduction and transcription. In the SCF complex, serves as an adapter that links the F-box protein to CUL1. The functional specificity of the SCF complex depends on the F-box protein as substrate recognition component. SCF(BTRC) and SCF(FBXW11) direct ubiquitination of CTNNB1 and participate in Wnt signaling. SCF(FBXW11) directs ubiquitination of phosphorylated NFKBIA. SCF(BTRC) directs ubiquitination of NFKBIB, NFKBIE, ATF4, SMAD3, SMAD4, CDC25A, FBXO5, CEP68 and probably NFKB2. SCF(SKP2) directs ubiquitination of phosphorylated CDKN1B/p27kip and is involved in regulation of G1/S transition. SCF(SKP2) directs ubiquitination of ORC1, CDT1, RBL2, ELF4, CDKN1A, RAG2, FOXO1A, and probably MYC and TAL1. SCF(FBXW7) directs ubiquitination of cyclin E, NOTCH1 released notch intracellular domain (NICD), and probably PSEN1. SCF(FBXW2) directs ubiquitination of GCM1. SCF(FBXO32) directs ubiquitination of MYOD1. SCF(FBXO7) directs ubiquitination of BIRC2 and DLGAP5. SCF(FBXO33) directs ubiquitination of YBX1. SCF(FBXO11) directs ubiquitination of BCL6 and DTL but does not seem to direct ubiquitination of TP53. SCF(BTRC) mediates the ubiquitination of NFKBIA at 'Lys-21' and 'Lys-22'; the degradation frees the associated NFKB1-RELA dimer to translocate into the nucleus and to activate transcription. SCF(CCNF) directs ubiquitination of CCP110. SCF(FBXL3) and SCF(FBXL21) direct ubiquitination of CRY1 and CRY2. SCF(FBXO9) directs ubiquitination of TTI1 and TELO2. SCF(FBXO10) directs ubiquitination of BCL2.
Protein Families SKP1 family
Database References

HGNC: 10899

OMIM: 601434

KEGG: hsa:6500

STRING: 9606.ENSP00000231487

UniGene: PMID: 27703147

  • Both the F-box domain of Skp2 and Skp1-Skp2 domain motions displaying preferential conformational control can together facilitate polyubiquitination of a wide variety of substrates. PMID: 26573739
  • Skp1 is critical to lung cancer pathogenesis PMID: 26474281
  • Data show that epithelial-mesenchymal transition (EMT)-transcription factors can be dynamically degraded by an atypical ubiquitin E3 ligase complex Skp1-Pam-Fbxo45 (SPFFbxo45). PMID: 25460509
  • We discuss how these results can explain the rapid association of Cdc34 and Skp1-cullin-F-box ligase (SCF). PMID: 25425648
  • SKP1 variation modifies association between Parkinson's disease and ubiquitin-proteasome system-inhibiting pesticides PMID: 23988235
  • Studies indicate that in SCFs, Rbx1 serves as the RING-containing enzyme, Cul1 is the Cullin scaffold, and Skp1 is an adaptor, which serves to link the beta-TrCP F-box substrate-specific factor to the rest of the ligase. PMID: 23624913
  • Substrate binding promotes formation of the Skp1-Cul1-Fbxl3 (SCF(Fbxl3)) protein complex. PMID: 24085301
  • Skp1-Cul1-F-box ubiquitin ligase (SCF(betaTrCP))-mediated destruction of the ubiquitin-specific protease USP37 during G2-phase promotes mitotic entry PMID: 23027877
  • Deconjugation of Nedd8 from Cul1 is directly regulated by Skp1-F-box and substrate, and the COP9 signalosome inhibits deneddylated SCF by a noncatalytic mechanism. PMID: 22767593
  • we determined that the phage-encoded GogB effector protein in Salmonella targets the host SCF E3 type ubiquitin ligase through an interaction with Skp1 and the human F-box only 22 (FBXO22) protein PMID: 22761574
  • This review suggested that SKP1 decreased in in sporadic Parkinson's disease. PMID: 22205206
  • phosphorylated NIPA is degraded in late mitosis in an APC/C(Cdh1)-dependent manner PMID: 22205987
  • SKP1-Cul1-F-box and leucine-rich repeat protein 4 (SCF-FbxL4) ubiquitin ligase regulates lysine demethylase 4A (KDM4A)/Jumonji domain-containing 2A (JMJD2A) protein PMID: 21757720
  • These observations suggest that Skp1 plays an important role in stabilizing the conformation of these F-box proteins, which increases their expression levels and substrate-binding. PMID: 21640084
  • Skp1 binding prevented Fbxo7 from contacting CRM1. PMID: 21378169
  • Data demonstrate that PFKFB3 is essential for cell division and that it is regulated by APC/C-Cdh1 and SKP1-CUL1-F (SCF)-beta-TrCP. PMID: 21402913
  • The siRNA-induced suppression of Skp2 increased p27 expression, decreased cellular proliferation, and increased apoptosis in human laryngeal carcinoma cells PMID: 20668394
  • These findings support a novel role for Hsp90-Sgt1 chaperones in ensuring the fidelity of Mis12 multiprotein complex assembly. PMID: 20404110
  • Skp1 and Fbg3 were co-expressed in E. coli. The plate-shaped crystals belonged to space group P2(1)2(1)2(1), with unit-cell parameters a = 34.1, b = 76.6, c = 193.9 A and one molecule per asymmetric unit. PMID: 20057081
  • OCP2 immunoreactivity is evident at a prenatal age of 11 weeks, peaks in expression at the onset of cochlear function at 20 weeks and achieves adult-like patterns of distribution just prior to histological maturation at 28 weeks. PMID: 12117534
  • Data show that interference with Skp1 function through expression of the Cul1-N252 mutant results in the formation of multinucleated cells, centrosome and mitotic spindle abnormalities, and impaired chromosome segregation. PMID: 12417738
  • SKP1 complexes with beta-TrCP1 and beta catenin. The destruction motif binding and lysine specificity of the SCF (beta-TrCP1) ubiquitin ligase were studied. PMID: 12820959
  • specific Elongin C and Skp1 sequences determine Cullin selection PMID: 15280393
  • the SCF complex (Skp1/Cul1/F-box protein/Roc1) intervenes in the surveillance of Cdh1 cellular abundance in S-phase PMID: 16123585
  • Treatment of cells with okadaic acid, a potent inhibitor of PP2A, results in various hyperphosphorylated forms of hSecurin which are extremely unstable, due to the action of the Skp1/Cul1/F-box protein complex ubiquitin ligase. PMID: 16705156
  • Thiazolidinediones modulate the expression of beta catenin and other cell cycle proteins by targeting SKP1 independently of PPARG. PMID: 17569795
  • p18-Cyclin E by the Skp1-Cul1-Fbw7 (SCF) complex and its interaction with the Fbw7 protein isoforms can take place independently of phosphorylation of p18-Cyclin E at a C-terminal phosphodegron. PMID: 18784078
  • The authors report that M-T5 can bind Akt and the host SCF complex (via Skp1) simultaneously in myxoma virus-infected cells. PMID: 19776120

    • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    More from All Products
    Tn5 Transposase
    • Expression system: E.coli;
    CAT#: TN5-BL01
    Sale
    SDS-PAGE analysis of Human SHFL (Shiftless Antiviral Inhibitor Of Ribosomal Frameshifting Protein) - Recombinant Protein, CAT# BLT-08873P showing >85% purity under 15% SDS-PAGE (Reduced)
    Human SHFL (Shiftless Antiviral Inhibitor Of Ribosomal Frameshifting Protein) - Recombinant Protein
    • Molecule: SHFL;
    • Species: Human;
    • Expression system: E.coli;
    • Tag: N-6His+sumo;
    • Sequence: 1-291;
    CAT#: BLT-08873P

    Save $50
    Sale
    SDS-PAGE analysis of Human NDUFV1 (Nadh Dehydrogenase [Ubiquinone] Flavoprotein 1, Mitochondrial) - Recombinant Protein, CAT# BLT-08321P, showing >90% purity under 15% SDS-PAGE (Reduced)
    Human NDUFV1 (Nadh Dehydrogenase [Ubiquinone] Flavoprotein 1, Mitochondrial) - Recombinant Protein
    • Molecule: NDUFV1;
    • Species: Human;
    • Expression system: E.coli;
    • Tag: N-6His+SUMO;
    • Sequence: 21-464aa;
    CAT#: BLT-08321P

    Save $50
    Sale
    SDS-PAGE analysis of Human NEU2 (Sialidase-2) - Recombinant Protein, CAT# BLT-08142P, showing >90% purity under 15% SDS-PAGE (Reduced)
    Human NEU2 (Sialidase-2) - Recombinant Protein
    • Molecule: NEU2;
    • Species: Human;
    • Expression system: E.coli;
    • Tag: N-6His;
    • Sequence: 1-380aa;
    CAT#: BLT-08142P

    Save $50
    Sale
    SDS-PAGE analysis of Mouse Cebpb (Ccaat/Enhancer-Binding Protein Beta) - Recombinant Protein, CAT# BLT-08014P, showing >90% purity under 15% SDS-PAGE (Reduced)
    Mouse Cebpb (Ccaat/Enhancer-Binding Protein Beta) - Recombinant Protein
    • Molecule: CEBPB;
    • Species: Mouse;
    • Expression system: E.coli;
    • Tag: N-His-GST;
    • Sequence: 1-296aa;
    CAT#: BLT-08014P

    Save $50
    Sale
    SDS-PAGE analysis of Human BAX (Apoptosis Regulator Bax) - Recombinant Protein, CAT# BLT-07419P, showing >90% purity under 15% SDS-PAGE (Reduced)
    Human BAX (Apoptosis Regulator Bax) - Recombinant Protein
    • Molecule: BAX;
    • Species: Human;
    • Expression system: E.coli;
    • Tag: N-6His;
    • Sequence: 1-171aa;
    CAT#: BLT-07419P

    Save $50
    Recently viewed