Recombinant Human Runt-Related Transcription Factor 3 (RUNX3) Protein (His&Myc)

Name: Recombinant Human Runt-Related Transcription Factor 3 (RUNX3) Protein (His&Myc)
Brand: Beta LifeScience
SKU: BLC-08900P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Runt-Related Transcription Factor 3 (RUNX3) Protein (His&Myc) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	Q13761
Target Symbol	RUNX3
Synonyms	Acute myeloid leukemia 2 protein; Acute myeloid leukemia gene 2; AML 2; AML2; CBF alpha 3; CBF-alpha-3; CBFA 3; CBFA3; Core binding factor alpha 3 subunit; core binding factor; Core binding factor runt domain alpha subunit 3; Core binding factor subunit alpha 3; core-binding factor; Core-binding factor subunit alpha-3; Oncogene AML 2; Oncogene AML-2; PEA2 alpha C; PEA2-alpha C; PEBP2 alpha C; PEBP2-alpha C; Pebp2a3; PEBP2aC; Polyomavirus enhancer binding protein 2 alpha C subunit; Polyomavirus enhancer-binding protein 2 alpha C subunit; runt domain alpha subunit 3 ; runt related transcription factor 3; Runt-related transcription factor 3; RUNX 3; Runx3; RUNX3_HUMAN; SL3 3 enhancer factor 1 alpha C subunit; SL3-3 enhancer factor 1 alpha C subunit; SL3/AKV core binding factor alpha C subunit; SL3/AKV core-binding factor alpha C subunit; Transcription factor AML2
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-10His&C-Myc
Target Protein Sequence	MRIPVDPSTSRRFTPPSPAFPCGGGGGKMGENSGALSAQAAVGPGGRARPEVRSMVDVLADHAGELVRTDSPNFLCSVLPSHWRCNKTLPVAFKVVALGDVPDGTVVTVMAGNDENYSAELRNASAVMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPTQVATYHRAIKVTVDGPREPRRHRQKLEDQTKPFPDRFGDLERLRMRVTPSTPSPRGSLSTTSHFSSQPQTPIQGTSELNPFSDPRQFDRSFPTLPTLTESRFPDPRMHYPGAMSAAFPYSATPSGTSISSLSVAGMPATSRFHHTYLPPPYPGAPQNQSGPFQANPSPYHLYYGTSSGSYQFSMVAGSSSGGDRSPTRMLASCTSSAASVAAGNLMNPSLGGQSDGVEADGSHSNSPTALSTPGRMDEAVWRPY
Expression Range	1-415aa
Protein Length	Full Length
Mol. Weight	49.4kDa
Research Area	Epigenetics And Nuclear Signaling
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Forms the heterodimeric complex core-binding factor (CBF) with CBFB. RUNX members modulate the transcription of their target genes through recognizing the core consensus binding sequence 5'-TGTGGT-3', or very rarely, 5'-TGCGGT-3', within their regulatory regions via their runt domain, while CBFB is a non-DNA-binding regulatory subunit that allosterically enhances the sequence-specific DNA-binding capacity of RUNX. The heterodimers bind to the core site of a number of enhancers and promoters, including murine leukemia virus, polyomavirus enhancer, T-cell receptor enhancers, LCK, IL3 and GM-CSF promoters. May be involved in the control of cellular proliferation and/or differentiation. In association with ZFHX3, upregulates CDKN1A promoter activity following TGF-beta stimulation. CBF complexes repress ZBTB7B transcription factor during cytotoxic (CD8+) T cell development. They bind to RUNX-binding sequence within the ZBTB7B locus acting as transcriptional silencer and allowing for cytotoxic T cell differentiation. CBF complexes binding to the transcriptional silencer is essential for recruitment of nuclear protein complexes that catalyze epigenetic modifications to establish epigenetic ZBTB7B silencing.
Subcellular Location	Nucleus. Cytoplasm.
Database References	HGNC: 10473 OMIM: 600210 KEGG: hsa:864 STRING: 9606.ENSP00000343477 UniGene: PMID: 29417297 RUNX3 creates an effective barrier against further TGFbeta-dependent tumor progression by preventing genomic instability. PMID: 29074538 Therefore miR199b may serve as an oncogene in Wilms' tumour (WT)progression by directly targeting RUNX3, thereby suggesting that the miR199b/RUNX3 axis may be a promising therapeutic target for patients with WT PMID: 29845298 High expression of miR-20a-5p significantly decreased both the mRNA and protein levels of RUNX3, as well as its direct downstream targets Bim and p21. PMID: 29864933 The present results suggested that methylation may serve a critical role in the silencing of RUNX3 and loss of RUNX3 expression may serve as a prognostic marker in endometrial cancer. PMID: 29693143 RUNX3 expression correlates with tumor's differentiation, depth of invasion, lymph node metastasis, distant metastasis, TNM stage and overall survival of gastric cancer patients. PMID: 29578091 MiR-182/HOXA9 was involved in the process of RUNX3-mediated GC tumor growth. PMID: 29054094 The BMP9-induced phosphorylation of Smad1/5/8 was increased with the overexpression of RUNX3, and yet was decreased with the knockdown of RUNX3. Collectively, our findings suggest that RUNX3 is an essential modulator of the BMP9-induced osteoblast lineage differentiation of mesenchymal stem cells (MSCs). PMID: 29039519 results suggest that EZH2 regulates cell proliferation potentially by targeting RUNX3 through the Wnt/beta-catenin signaling pathway in laryngeal carcinoma. PMID: 28795320 These findings suggested that RUNX3 played a tumor suppressor role in oral squamous cell carcinoma (OSCC) by inhibiting cell migration, invasion and angiogenesis, supporting that it could be a potential therapeutic target for OSCC PMID: 28765934 Study showed that Runx3 was found a target of miR-106b, and the inhibition of miR-106b upregulated Runx3. These results provide evidence that Runx3 is a tumor-suppressor in retinoblastoma and is a target of miR-106b. PMID: 28901461 Our results support the ability of Runx3 to contribute to the dissemination of human PDAC thus confirming the observations from murine models. PMID: 28882948 High expression of RUNX3 is correlated with gastric cancer. PMID: 27566570 RUNX3 is a common downstream target of TGF-beta and Notch signaling, and may be a novel therapeutic target for treating CVD mediated by EndMT. PMID: 28534977 CNRIP1 and RUNX3 as potential DNA methylation biomarkers for CRC diagnosis and treatment PMID: 28940471 RUNX3 expression in oral squamous carcinoma cells contributes to their bone invasion and the resulting osteolysis by inducing their malignant behaviors and production of osteolytic factors. PMID: 28030842 Lower positive expression rate of RUNX3 and higher positive expression rate of Notch1 and Jagged 1 were observed in CRC tissues than those in normal adjacent tissues with a negative correlation, and the expression levels were associated with the differentiation degree, TNM staging, lymph node metastasis and tumor invasion depth (all P<0.05). PMID: 28498402 Loss of RUNX3 expression strongly correlated with adverse prognosis, independent of subtype. Further studies are warranted to elucidate the biology and prognostic utility of RUNX3 in DLBCL. PMID: 27184221 Runx3 plays a critical role in R-point regulation and defense against cellular transformation. PMID: 28846108 RUNX3 mRNA and protein expression were upregulated in nasal-type extranodal NK/T-cell lymphoma (NKTL) patient samples and NKTL cell lines compared to normal NK cells. RUNX3 silenced NKTL cells showed increased apoptosis and reduced cell proliferation. MYC and RUNX3 binding occurs. Potential binding sites for MYC were identified in the RUNX3 enhancer region. PMID: 28119527 The methylation status of Runx3 gene are abnormal in Hepatocellular Carcinoma patients, which may further be used as molecular markers for early diagnosis of Liver cancer. PMID: 29019900 RUNX 3 hypermethylation is associated with breast cancer. PMID: 27825140 High RUNX3 expression is associated with gastric cancer. PMID: 27425596 we present evidence that RUNX3 can act as a tumor suppressor in a human T-cell malignancy and suggest that this effect is predominantly mediated through transcripts from its distal promoter, in particular RUNX3/p46. PMID: 27377697 Our results from clinical samples also suggest that Threonine 209 phosphorylation by Pak1 could be a potential therapeutic target and of great clinical relevance with implications for Runx3 inactivation in cancer cells where Runx3 is known to be oncogenic. The findings presented in this study provide evidence of Runx3-Threonine 209 phosphorylation as a molecular switch in dictating the tissue-specific dualistic functions PMID: 26898755 RUNX3 acts as a tumour suppressor PMID: 26364597 MicroRNA-145 could regulate the balance of Th1/Th2 through targeting the RUNX3 in asthma patients. PMID: 27902892 The miR-29b/KDM2A axis was involved in the RUNX3-mediated inhibition of gastric cancer cell proliferation and metastasis. PMID: 27497248 RUNX3 methylation level is associated with gastric cancer (GC), especially the methylation at site -1415 contributes to the poor prognosis in GC. PMID: 27664488 The hypermethylation of RUNX3 in AFB1-transformed hepatocytes and human hepatocellular carcinomas implicates RUNX3 as a tumor suppressor gene PMID: 28458013 our results suggest that an aberrant messenger RNA expression may be the outcome of CpG, CHG, and CHH methylation in O(6)-methylguanine-DNA methyltransferase, whereas outcome of CHG and CHH methylation in runt-related transcription factor 3 promoters along with risk factors such as consumption of tobacco, betel nut, and smoking habits in esophageal cancer from Northeast India PMID: 28468586 IFNgamma promotes double strabded RNA-induced TLR3-dependent apoptosis via upregulation of transcription factor Runx3 in airway epithelial cells. PMID: 27793801 Knockdown of RUNX3 in HCMECs attenuates hypoxia-induced EndoMT via partially inhibiting TGF-beta and Notch signaling pathway. PMID: 27916094 The genetic association of RUNX3 with ankylosing spondylitis can be explained by allele-specific effects on IRF4 recruitment that alter gene expression. PMID: 26452539 the Notch pathway component RBP-J is required for EBNA2 activation of RUNX3 and reveal additional coactivation of RUNX3 by EBNA3B and 3C PMID: 26883634 HDAC1- and SRC-mediated phosphorylation of RUNX3 induced by oxidative stress is associated with the cytoplasmic localization of RUNX3 and can lead to RUNX3 inactivation and carcinogenesis. PMID: 27990641 the present study suggested that RUNX3 regulated the differentiation of Th17 and Th22 cells in psoriasis, providing a promising therapeutic strategy for the treatment of psoriasis. PMID: 27082311 miR-20a overexpression contributed to hepatocellular carcinoma cell proliferation and migration through reducing the translation of RUNX3. PMID: 27748919 RUNX3 plays an important role in As2O3induced cellular responses and allows cells to overcome mesenchymal stem cellmediated drug resistance PMID: 27498627 Results confirmed that a loss of RUNX3 in esophageal squamous cell carcinoma may contribute to cisplatin-resistance. PMID: 27766776 The RUNX3 gene promoter methylation rate was much higher in tumor tissue than that in normal gastric tissue in patient with gastric cancer, which indicates a close association between gastric cancer and RUNX3 gene promoter methylation. PMID: 27721253 RUNX3 overexpression inhibited CRC cell migration and invasion resulting from the upregulation of matrix metalloproteinase-2 (MMP-2) and MMP-9 expression. the knockdown of RUNX3 reduced the inhibition of migration and invasion of CRC cells. Finally, we found that restoration of RUNX3 decreased vascular endothelial growth factor (VEGF) secretion and suppressed endothelial cell growth and tube formation PMID: 27633042 RUNX3 promoter methylation is linked to the origin of HCC but not to its progression from non-metastatic to metastatic stages. PMID: 27420934 hypermethylation modifications of CpG13, CpG14, and CpG15 in the promoter region of Runx3 could result in the down regulation of Runx3 expression to affect the prognosis of Chronic Atrophic Gastritis Patients. So the methylation levels of these CpG sites in Runx3 in the peripheral blood can be used as the biomarker for predicting the healing prognosis of Chronic Atrophic Gastritis Patients patients. PMID: 27196446 miR-148a-3p may regulate RUNX3 expression through the modulation of DNMT1-dependent DNA methylation in laryngeal squamous cell carcinoma. PMID: 27859417 miR-130b expression was downregulated, while RUNX3 mRNA was upregulated, in EOC tissues compared to normal ovarian tissues (both P=0.001). Importantly, the expression level of miR-130b in EOC tissues was negatively correlated with that of RUNX3 mRNA significantly. PMID: 27048832 N-myc protein also could bind to the promoter of pri-miR-4295 and inhibit the expression of RUNX3 in glioma cells. PMID: 26756701 miR-532-5p functions as an oncogenic miRNA by promoting cell growth, migration and invasion in human gastric cancer cells via regulation of RUNX3 gene expression. PMID: 26515139 loss of RUNX3 expression contributed to 5-FU and CDDP resistance by inducing multidrug resistance proteins expression. PMID: 26985715 Results show up-regulation of TrkB and down-regulation of Runx3 and Keap1 in breast cancer cells and suggest that TrkB plays a key role in tumorigenicity and metastasis of breast cancer cells through suppression of Runx3 or Keap1. PMID: 26657794

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.