Recombinant Human ROPN1 Protein (N-10xHis & C-Myc)
Beta LifeScience
SKU/CAT #: BLC-11432P
Greater than 85% as determined by SDS-PAGE.
Recombinant Human ROPN1 Protein (N-10xHis & C-Myc)
Beta LifeScience
SKU/CAT #: BLC-11432P
Regular price
$94900
$949.00
Sale price$24000
$240.00Save $709
/
Submit an inquiry or email sales for a custom bulk quote. Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Uniprotkb | Q9HAT0 |
| Target Symbol | ROPN1 |
| Species | Human |
| Expression System | Baculovirus |
| Tag | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| Target Protein Sequence | MAQTDKPTCIPPELPKMLKEFAKAAIRVQPQDLIQWAADYFEALSRGETPPVRERSERVALCNRAELTPELLKILHSQVAGRLIIRAEELAQMWKVVNLPTDLFNSVMNVGRFTEEIEWLKFLALACSALGVTITKTLKIVCEVLSCDHNGGSPRIPFSTFQFLYTYIAKVDGEISASHVSRMLNYMEQEVIGPDGIITVNDFTQNPRVQLE |
| Expression Range | 1-212aa |
| Protein Length | Full Length |
| Mol. Weight | 27.9 kDa |
| Research Area | Cell Biology |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Target Function | Important for male fertility. With ROPN1L, involved in fibrous sheath integrity and sperm motility, plays a role in PKA-dependent signaling processes required for spermatozoa capacitation. |
| Subcellular Location | Cell projection, cilium, flagellum. |
| Protein Families | Ropporin family |
| Database References |
HGNC: 17692 KEGG: hsa:54763 STRING: 9606.ENSP00000184183 UniGene: Hs.567516 |
| Tissue Specificity | Testis specific in adult. Overexpressed in hematologic tumor cells. |

