Recombinant Human Rna-Binding Protein Ro60 (TROVE2) Protein (His)

Beta LifeScience SKU/CAT #: BLC-05278P
Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SDS-PAGE.

Recombinant Human Rna-Binding Protein Ro60 (TROVE2) Protein (His)

Beta LifeScience SKU/CAT #: BLC-05278P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Human Rna-Binding Protein Ro60 (TROVE2) Protein (His) is produced by our E.coli expression system. This is a protein fragment.
Purity Greater than 90% as determined by SDS-PAGE.
Uniprotkb P10155
Target Symbol TROVE2
Synonyms 60 kDa ribonucleoprotein Ro; 60 kDa Ro protein; 60 kDa SS A/Ro ribonucleoprotein; 60 kDa SS-A/Ro ribonucleoprotein; Autoantigen Ro/SSA, 60-KD; bA101E13.2; Gastric cancer multi drug resistance protein; Ribonucleoprotein autoantigen SS A/Ro; RO 60; Ro 60 kDa autoantigen; RO60; RO60_HUMAN; RoRNP; Sjoegren syndrome antigen A2; Sjoegren syndrome type A antigen; Sjogren syndrome antigen A2 (60kD ribonucleoprotein autoantigen SS A/Ro); Sjogren syndrome antigen A2 (60kDa ribonucleoprotein autoantigen SS A/Ro); Sjogren syndrome antigen A2; SS A; SS-A; SS-A/Ro; SSA 2; SSA; SSA2; TROVE 2; TROVE domain family member 2; TROVE2
Species Homo sapiens (Human)
Expression System E.coli
Tag N-6His
Target Protein Sequence ESVNQMQPLNEKQIANSQDGYVWQVTDMNRLHRFLCFGSEGGTYYIKEQKLGLENAEALIRLIEDGRGCEVIQEIKSFSQEGRTTKQEPMLFALAICSQCSDISTKQAAFKAVSEVCRIPTHLFTFIQFKKDLKESMKCGMWGRALRKAIADWYNEKGGMALALAVTKYKQRNGWSHKDLLRLSHLKPSSEGLAIVTKYITKGWKEVHELYKEKALSVETEKLLKYLEAVEKVKRTRDELEVIHLIEEHRLVREHLLTNHLKSKEVWKALLQEMPLTALLRNLGKMTANSVLEPGNSEVSLVCEKLCNEKLLKKARIHPFHILIALETYKTGHGLRGKLKWRPDEEILKALDAAFYKTFKTVEPTGKRFLLAVDVSASMNQRVLGSILNASTVAAAMCMVVTRTEKDSYVVAFSDEMVPCPVTTDMTLQQVLMAMSQIPAGGTDCSLPMIWAQKTNTPADVFIVFTDNETFAGGVHPAIALREYRKKMDIPAKLIVCGMTSNGFTIADPDDRGMLDMCGFDTGALDVIRNFTL
Expression Range 3-535aa
Protein Length Partial
Mol. Weight 64.1kDa
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function RNA-binding protein that binds to misfolded non-coding RNAs, pre-5S rRNA, and several small cytoplasmic RNA molecules known as Y RNAs. May stabilize some of these RNAs and protect them from degradation. Binds to endogenous Alu retroelements which are induced by type I interferon and stimulate porinflammaotry cytokine secretion. Regulates the expression of Alu retroelements as well as inflammatory genes.; May play roles in cilia formation and/or maintenance.
Subcellular Location Cytoplasm. Note=Localized in cytoplasmic mRNP granules containing untranslated mRNAs.
Protein Families Ro 60 kDa family
Database References

HGNC: 11313

OMIM: 600063

KEGG: hsa:6738

STRING: 9606.ENSP00000356411

UniGene: PMID: 26307612

  • Significant relationships were found between clinical and laboratory manifestations of autoimmune and rheumatic diseases with different patterns of antibodies to anti-Ro52, anti-Ro60 and anti-La. PMID: 26725021
  • These findings establish a link among the lupus autoantigen Ro60, Alu retroelements, and type I interferon. PMID: 26382853
  • Findings indicate a relentless turnover of short-lived clonotypic variants, masquerading as long-lived Ro60 humoral autoimmunity. PMID: 23644453
  • The Y3 RNA moiety of the Ro60 ribonucleoprotein plays a critical role in the pathogenesis of fetal cardiac injury by altering the subcellular location of Ro60 autoantibodies. PMID: 23698747
  • these data indicate that ZBP1 may function as an adapter to export the Ro/Y3 RNA complex from nuclei. PMID: 22114317
  • conclude that RNPs containing hY RNAs and Ro60, La or nucleolin are not required for the function of hY RNAs in chromosomal DNA replication in a human cell-free system, which can be mediated by Y RNAs outside of these RNPs PMID: 21060685
  • dichotomy of human autoantibody responses against mutually exclusive determinants linked to a single domain of a systemic autoantigen and supports a model in which tolerance is broken by different immunogenic forms of Ro 60 PMID: 20131295
  • Activation of Toll-like receptors by fetal factor Ro60-associated single-stranded RNA particles is relevant in autoimmune-associated congenital heart block, where the obligate maternal factor is an anti-SSA/Ro autoantibody. PMID: 20089705
  • In viitro RNA chaperone activity of SSA2 was studied. PMID: 15928345
  • The structural organization and Zn2+-dependent subdomain interactions involving autoiantigenic epitopes in the RBBC region of SS-A were studied. PMID: 15964842
  • interactions between Ro-Y5 and L5-5S RNPs establish 5S RNA as a target of quality control PMID: 18056422
  • results demonstrate that Ro 60 functions as a novel receptor for beta(2)GPI on the surface of apoptotic cells. The formation of Ro 60-beta(2)GPI complexes may protect against anti-Ro 60 autoantibody-mediated tissue injury. PMID: 19248095

    • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    More from All Products
    Tn5 Transposase
    • Expression system: E.coli;
    CAT#: TN5-BL01
    Sale
    SDS-PAGE analysis of Human SHFL (Shiftless Antiviral Inhibitor Of Ribosomal Frameshifting Protein) - Recombinant Protein, CAT# BLT-08873P showing >85% purity under 15% SDS-PAGE (Reduced)
    Human SHFL (Shiftless Antiviral Inhibitor Of Ribosomal Frameshifting Protein) - Recombinant Protein
    • Molecule: SHFL;
    • Species: Human;
    • Expression system: E.coli;
    • Tag: N-6His+sumo;
    • Sequence: 1-291;
    CAT#: BLT-08873P

    Save $50
    Sale
    SDS-PAGE analysis of Human SFTPA1 (Pulmonary Surfactant-Associated Protein A1) - Recombinant Protein, CAT# BLT-08790P showing >90% purity under 15% SDS-PAGE (Reduced)
    Human SFTPA1 (Pulmonary Surfactant-Associated Protein A1) - Recombinant Protein
    • Molecule: SFTPA1;
    • Species: Human;
    • Expression system: E.coli;
    • Tag: N-6His;
    • Sequence: 21-248;
    CAT#: BLT-08790P

    Save $50
    Sale
    SDS-PAGE analysis of Human SFTPA2 (Pulmonary Surfactant-Associated Protein A2) - Recombinant Protein, CAT# BLT-08789P showing >90% purity under 15% SDS-PAGE (Reduced)
    Human SFTPA2 (Pulmonary Surfactant-Associated Protein A2) - Recombinant Protein
    • Molecule: SFTPA2;
    • Species: Human;
    • Expression system: E.coli;
    • Tag: N-6His;
    • Sequence: 21-248;
    CAT#: BLT-08789P

    Save $50
    Sale
    SDS-PAGE analysis of Human NDUFV1 (Nadh Dehydrogenase [Ubiquinone] Flavoprotein 1, Mitochondrial) - Recombinant Protein, CAT# BLT-08321P, showing >90% purity under 15% SDS-PAGE (Reduced)
    Human NDUFV1 (Nadh Dehydrogenase [Ubiquinone] Flavoprotein 1, Mitochondrial) - Recombinant Protein
    • Molecule: NDUFV1;
    • Species: Human;
    • Expression system: E.coli;
    • Tag: N-6His+SUMO;
    • Sequence: 21-464aa;
    CAT#: BLT-08321P

    Save $50
    Sale
    SDS-PAGE analysis of Human NEU2 (Sialidase-2) - Recombinant Protein, CAT# BLT-08142P, showing >90% purity under 15% SDS-PAGE (Reduced)
    Human NEU2 (Sialidase-2) - Recombinant Protein
    • Molecule: NEU2;
    • Species: Human;
    • Expression system: E.coli;
    • Tag: N-6His;
    • Sequence: 1-380aa;
    CAT#: BLT-08142P

    Save $50
    Recently viewed