Recombinant Human Ring Finger Protein 11 (RNF11) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-10460P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Ring Finger Protein 11 (RNF11) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-10460P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Ring Finger Protein 11 (RNF11) Protein (His) is produced by our Yeast expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | Q9Y3C5 |
| Target Symbol | RNF11 |
| Synonyms | CGI 123; RING finger protein 11; RNF11; RNF11_HUMAN; Sid 1669; SID1669 |
| Species | Homo sapiens (Human) |
| Expression System | Yeast |
| Tag | N-6His |
| Target Protein Sequence | GNCLKSPTSDDISLLHESQSDRASFGEGTEPDQEPPPPYQEQVPVPVYHPTPSQTRLATQLTEEEQIRIAQRIGLIQHLPKGVYDPGRDGSEKKIRECVICMMDFVYGDPIRFLPCMHIYHLDCIDDWLMRSFTCPSCMEPVDAALLSSYETN |
| Expression Range | 2-154aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 19.3kDa |
| Research Area | Epigenetics And Nuclear Signaling |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Essential component of a ubiquitin-editing protein complex, comprising also TNFAIP3, ITCH and TAX1BP1, that ensures the transient nature of inflammatory signaling pathways. Promotes the association of TNFAIP3 to RIPK1 after TNF stimulation. TNFAIP3 deubiquitinates 'Lys-63' polyubiquitin chains on RIPK1 and catalyzes the formation of 'Lys-48'-polyubiquitin chains. This leads to RIPK1 proteasomal degradation and consequently termination of the TNF- or LPS-mediated activation of NF-kappa-B. Recruits STAMBP to the E3 ubiquitin-ligase SMURF2 for ubiquitination, leading to its degradation by the 26S proteasome. |
| Subcellular Location | Early endosome. Recycling endosome. Cytoplasm. Nucleus. |
| Database References | HGNC: 10056 OMIM: 612598 KEGG: hsa:26994 STRING: 9606.ENSP00000242719 UniGene: PMID: 28292929 |
![SDS-PAGE analysis of Human NDUFV1 (Nadh Dehydrogenase [Ubiquinone] Flavoprotein 1, Mitochondrial) - Recombinant Protein, CAT# BLT-08321P, showing >90% purity under 15% SDS-PAGE (Reduced)](http://www.betalifesci.com/cdn/shop/files/1ihmbkjr21vdmc6j_{width}x.jpg?v=1753363793)
