Recombinant Human Ring-Box Protein 2 (RNF7) Protein (GST)

Name: Recombinant Human Ring-Box Protein 2 (RNF7) Protein (GST)
Brand: Beta LifeScience
SKU: BLC-10270P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) RNF7.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins, Recombinant proteins fall special offers - full-length proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Ring-Box Protein 2 (RNF7) Protein (GST) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	Q9UBF6
Target Symbol	RNF7
Synonyms	CKBBP 1; CKBBP1; CKII beta binding protein 1; CKII beta-binding protein 1; Rbx 2; Rbx2; RBX2_HUMAN; Regulator of cullins 2; RING box protein 2; RING finger protein 7; RING-box protein 2; RNF 7; RNF7; ROC 2; ROC2; SAG; Sensitive to apoptosis gene; Sensitive to apoptosis gene protein; Zinc RING finger protein SAG
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-GST
Target Protein Sequence	ADVEDGEETCALASHSGSSGSKSGGDKMFSLKKWNAVAMWSWDVECDTCAICRVQVMDACLRCQAENKQEDCVVVWGECNHSFHNCCMSLWVKQNNRCPLCQQDWVVQRIGK
Expression Range	2-113aa
Protein Length	Full Length of Mature Protein
Mol. Weight	39.6kDa
Research Area	Epigenetics And Nuclear Signaling
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Probable component of the SCF (SKP1-CUL1-F-box protein) E3 ubiquitin ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins involved in cell cycle progression, signal transduction and transcription. CRLs complexes and ARIH1 collaborate in tandem to mediate ubiquitination of target proteins, ARIH1 mediating addition of the first ubiquitin on CRLs targets. Through the RING-type zinc finger, seems to recruit the E2 ubiquitination enzyme to the complex and brings it into close proximity to the substrate. Promotes the neddylation of CUL5 via its interaction with UBE2F. May play a role in protecting cells from apoptosis induced by redox agents.
Subcellular Location	Cytoplasm. Nucleus.
Protein Families	RING-box family
Database References	HGNC: 10070 OMIM: 603863 KEGG: hsa:9616 STRING: 9606.ENSP00000273480 UniGene: PMID: 28252001 Results identified RNF7 to interact with CARMA2 regulating its NF-kappaB-activating capacity. Mechanistically, RNF7 influences CARMA2 signaling by regulating the ubiquitination state of MALT1 and the NF-kappaB-regulatory molecule NEMO. PMID: 29194363 Sag is a Kras-cooperating oncogene that promotes lung tumorigenesis PMID: 24430184 NEDD4-1 overexpression sensitizes cancer cells to etoposide-induced apoptosis by reducing SAG levels through targeted degradation. SAG is added to a growing list of NEDD4-1 substrates and mediates its biological function. PMID: 25216516 RNF7 gene variant is associated with the risk of developing liver fibrosis and cirrhosis in an Eastern European population. PMID: 28338112 MAF1, RNF7 and SETD3 are identified as PCNA-associated proteins in human cells and given this interaction with PCNA, Maf1, RNF7, and SetD3 are potentially involved in DNA replication, DNA repair, or associated processes. PMID: 26030842 These findings indicate that Rbx1 and Rbx2 can both activate Cul5-Vif E3 ligase in vitro, but they may undergo a more delicate selection mechanism in vivo. PMID: 25912140 Single nucleotide polymorphism rs16851720 was associated with liver fibrosis progression. PMID: 22841784 Data suggest that the sensitive-to-apoptosis gene may be a candidate gene for good prognosis in rectal cancer, independent of therapeutic response of different individuals. PMID: 22171132 SAG plays an important role in regulating ionizing radiation-induced apoptosis PMID: 20933570 The findings showed that SAG E3 ubiquitin ligase plays an essential role in cancer cell proliferation and tumor growth PMID: 20103673 SAG possesses a potent peroxidase property to decompose hydrogen peroxide in the presence of dithiothreitol PMID: 11999705 results show that the Ring-H2 finger motif of CKBBP1 is necessary for efficient binding to CKIIbeta, as well as for optimal cell proliferation PMID: 12470599 sensitive to apoptosis gene protein inhibits peroxynitrite-induced DNA damage. PMID: 12565832 results indicate that protein kinase CKII may control IkappaBalpha and p27Kip1 degradation and thereby G1/S phase transition through the phosphorylation of threonine 10 within CKBBP1 protein PMID: 12748192 These studies suggested that CK2 might regulate SAG-SCF E3 ligase activity through modulating SAG's stability, rather than its enzymatic activity directly. PMID: 16874460 Endogenous levels of pro-caspase 3 were decreased by overexpression of SAG protein. PMID: 17217622 Promotes hypoxia-inducible factor 1 alpha subunit (HIF-1 alpha) ubiquitination and degradation. PMID: 17828303 Sensitive to apoptosis gene may play an important role in regulating the apoptosis induced by heat shock presumably through maintaining the cellular redox status. PMID: 18454945

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.