Recombinant Human Ribonuclease T2 (RNASET2) Protein (His-Myc)

Name: Recombinant Human Ribonuclease T2 (RNASET2) Protein (His-Myc)
Brand: Beta LifeScience
SKU: BLC-07703P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Product Overview

Description	Recombinant Human Ribonuclease T2 (RNASET2) Protein (His-Myc) is produced by our Yeast expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	O00584
Target Symbol	RNASET2
Synonyms	Ribonuclease 6
Species	Homo sapiens (Human)
Expression System	Yeast
Tag	C-6His-Myc
Target Protein Sequence	DKRLRDNHEWKKLIMVQHWPETVCEKIQNDCRDPPDYWTIHGLWPDKSEGCNRSWPFNLEEIKDLLPEMRAYWPDVIHSFPNRSRFWKHEWEKHGTCAAQVDALNSQKKYFGRSLELYRELDLNSVLLKLGIKPSINYYQVADFKDALARVYGVIPKIQCLPPSQDEEVQTIGQIELCLTKQDQQLQNCTEPGEQPSPKQEVWLANGAAESRGLRVCEDGPVFYPPPKKTKH
Expression Range	25-256aa
Protein Length	Full Length of Mature Protein
Mol. Weight	30.9 kDa
Research Area	Cancer
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Ribonuclease that plays an essential role in innate immune response by recognizing and degrading RNAs from microbial pathogens that are subsequently sensed by TLR8. Cleaves preferentially single-stranded RNA molecules between purine and uridine residues, which critically contributes to the supply of catabolic uridine and the generation of purine-2',3'-cyclophosphate-terminated oligoribonucleotides. In turn, RNase T2 degradation products promote the RNA-dependent activation of TLR8. Plays also a key role in degradation of mitochondrial RNA and processing of non-coding RNA imported from the cytosol into mitochondria. Participates as well in degradation of mitochondrion-associated cytosolic rRNAs.
Subcellular Location	Secreted. Lysosome lumen. Endoplasmic reticulum lumen. Mitochondrion intermembrane space.
Protein Families	RNase T2 family
Database References	HGNC: 21686 OMIM: 612944 KEGG: hsa:8635 STRING: 9606.ENSP00000422846 UniGene: Hs.529989
Associated Diseases	Leukoencephalopathy, cystic, without megalencephaly (LCWM)
Tissue Specificity	Ubiquitous. Higher expression levels observed in the temporal lobe and fetal brain.

Gene Functions References

High RNASET2 expression is associated with reduced sperm motility. PMID: 29581387
Studied association of and RNASET2, GPR174, and PTPN22 gene polymorphisms and liver damage(LD) due to Graves' disease (GD) hyperthyroidism. Found GPR174 rs3827440, PTPN22 rs3789604, and RNASET2 rs9355610 were significantly associated with altered GD-derived LD risk. PMID: 28568286
RNASET2 is the enzyme that degrades the RNAs PMID: 28730546
RNASET2, an IBD susceptibility gene, is a component of TL1A-mediated pathways regulating cytokine production. PMID: 28400196
inhibits melanocyte outgrowth through interacting with shootin1; this effect may be associated with vitiligo pathogenesis PMID: 26293343
Biological features allow to put forward the hypothesis that the RNASET2 protein can act as a molecular barrier for limiting the damages and tissue remodeling events occurring during the earlier step of cell transformation. PMID: 25797262
RNASET2 may contribute to the development of vitiligo by inhibiting TNF Receptor-Associated Factor 2 expression and lead directly to apoptosis of melanocytes PMID: 26067323
describe a multi-step strategy that allows production of highly pure, catalytically competent recombinant RNASET2 in both wild-type and mutant forms PMID: 25663099
RNASET2 has antitumorigenic and antiangiogenic activities; a truncated version of human RNASET2, starting at E50 (trT2-50) and devoid of ribonuclease activity, has actin binding and anticancer-related biological activities PMID: 25426551
RNASET2 tag SNP but not CCR6 polymorphisms is associated with autoimmune thyroid diseases in the Chinese Han population PMID: 25928629
Results show that downregulation of RNASET2 and GGNBP2 in drug-resistant ovarian cancer tissues/cells contributes to the regulation of drug resistance in ovarian cancer. PMID: 24842157
RNASET2 contributes to vitiligo pathogenesis by inhibiting TRAF2 expression. PMID: 24457966
Genotypes of single nucleotide polymorphisms (SNPs) in RNASET2 gene were determined. PMID: 24327149
Ribonuclease T2, an ancient and phylogenetically conserved RNase, has a role in development of ovarian neoplasms PMID: 23630276
Higher expression of RNASET2 in the semen of asthenozoospermia individuals may contribute to sperm motility impairment. PMID: 23258633
RNASET2--an autoantigen in anaplastic large cell lymphoma identified by protein array analysis. PMID: 22732457
The catalytic features of RNase T2 in presence of bivalent cations were analyzed and the structural consequences of known clinical mutations were investigated. PMID: 22735700
a possible involvement of RNASET2 in P-body formation in mammalian cells. PMID: 22188480
Tax represses expression of RNase T2. PMID: 21994792
Molecular signature induced by RNASET2, a tumor antagonizing gene, in ovarian cancer cells. PMID: 21646684
The expression of the human tumor suppressor protein RNASET2 was studied in baculovirus-insect cell and Pichia pastoris heterologous systems. PMID: 21446958
Familial cystic leukoencephalopathy arising in RNASET2-deficient humans is a manifestation of an lysosomal storage disorders in which rRNA is the best candidate for the noxious storage material. PMID: 21199949
RNaseT2 is a cell growth regulator and it does not induce senescence in SV40 immortalized cell lines. PMID: 19382914
RNASET2 found to significantly decrease the metastatic potential of ovarian cancer cell line in vivo; tumor suppression by RNASET2 is suggested to not be mediated by its ribonuclease activity PMID: 15809705
The results presented herein represent a further advancement toward the molecular understanding of the tumour suppressive properties of the human RNASET2 protein. PMID: 16620762
Loss of RNASET2 is associated with melanoma PMID: 18543608
Study shows that loss-of-function mutations in the gene encoding the RNASET2 glycoprotein lead to cystic leukoencephalopathy, an autosomal recessive disorder with an indistinguishable clinical and neuroradiological phenotype. PMID: 19525954

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.