Recombinant Human Rho Guanine Nucleotide Exchange Factor 7 (ARHGEF7) Protein (GST)

Beta LifeScience SKU/CAT #: BLC-08506P
Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SDS-PAGE.

Recombinant Human Rho Guanine Nucleotide Exchange Factor 7 (ARHGEF7) Protein (GST)

Beta LifeScience SKU/CAT #: BLC-08506P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Human Rho Guanine Nucleotide Exchange Factor 7 (ARHGEF7) Protein (GST) is produced by our E.coli expression system. This is a protein fragment.
Purity Greater than 90% as determined by SDS-PAGE.
Uniprotkb Q14155
Target Symbol ARHGEF7
Synonyms ARHG7; ARHG7_HUMAN; ARHGEF 7; Arhgef7; Beta pix; Beta-Pix; betaPix; betaPix-b; betaPix-c; Cool; COOL-1; COOL1; DKFZp686C12170; DKFZp761K1021; KIAA0142; KIAA0412; mKIAA0142; Nbla10314; P50; P50BP; p85; P85COOL1; P85SPR; PAK interacting exchange factor beta; PAK-interacting exchange factor beta; PAK3; Pak3bp; PIX; PIXB; Rho guanine nucleotide exchange factor (GEF) 7; Rho guanine nucleotide exchange factor (GEF) 7b; Rho guanine nucleotide exchange factor (GEF7); Rho guanine nucleotide exchange factor 7; SH3 domain containing proline rich protein
Species Homo sapiens (Human)
Expression System E.coli
Tag N-GST
Target Protein Sequence MTDNSNNQLVVRAKFNFQQTNEDELSFSKGDVIHVTRVEEGGWWEGTLNGRTGWFPSNYVREVKASEKPVSPKSGTLKSPPKGFDTTAINKSYYNVVLQNILETENEYSKELQTVLSTYLRPLQTSEKLSSANISYLMGNLEEICSFQQMLVQSLEECTKLPEAQQRVGGCFLNLMPQMKTLYLTYCANHPSAVNVLTEHSEELGEFMETKGASSPGILVLTTGLSKPFMRLDKYPTLLKELERHMEDYH
Expression Range 179-428aa
Protein Length Partial
Mol. Weight 55.3kDa
Research Area Neuroscience
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Acts as a RAC1 guanine nucleotide exchange factor (GEF) and can induce membrane ruffling. Functions in cell migration, attachment and cell spreading. Promotes targeting of RAC1 to focal adhesions. May function as a positive regulator of apoptosis. Downstream of NMDA receptors and CaMKK-CaMK1 signaling cascade, promotes the formation of spines and synapses in hippocampal neurons.
Subcellular Location Cell junction, focal adhesion. Cell projection, ruffle. Cytoplasm, cell cortex. Cell projection, lamellipodium. Note=Detected at cell adhesions. A small proportion is detected at focal adhesions.
Database References

Gene Functions References

  1. Traction forces generated by beta-PIX knockdown cells are increased relative to those in control cells, a result consistent with an unexpected enhancement in the migration of single beta-PIX knockdown cells and monolayers of such cells. Authors propose that targeting beta-PIX might be a means of promoting epithelialization of wounds in vivo. PMID: 28596238
  2. S340E mutation enhances Nox1 activation (Kaito et al., 2014), the present study suggests that betaPix can also play an inhibitory role in O2(-) production, depending on the sites of phosphorylation. PMID: 29242061
  3. Data suggest that Scribble PDZ-domain-1 and PDZ-domain-3 are major domains that interact with beta-PIX and exhibit distinct binding hierarchy in interactions between individual Scribble PDZ domains and beta-PIX. (Scribble = scribbled planar cell polarity protein; beta-PIX = Rho guanine nucleotide exchange factor 7) PMID: 29061852
  4. each mutation in LRRK2 and ARHGEF7 demonstrated its unique functional property, which may contribute to the pathogenesis of Parkinson disease PMID: 27423549
  5. we discuss recent findings in key physiological systems that exemplify current understanding of the function of this important regulatory complex. Further, we draw attention to gaps in crucial information that remain to be filled to allow a better understanding of the many roles of the GIT-PIX complex in health and disease PMID: 27182061
  6. Data show association of G protein-coupled receptor kinase-interacting protein 1 (GIT1), p21-activated kinase interacting exchange factor (betaPIX), and p21 protein (Cdc42/Rac)-activated kinase 1 (PAK1) with centrosomes. PMID: 27012601
  7. Data show the role of Rho guanine nucleotide exchange factor 7 (beta-PIX) to the regulation of high mobility of lung adenocarcinoma cell line H1299 via regulation of focal adhesions dynamics, changes in actin cytoskeleton organization and cell polarity. PMID: 25683605
  8. Phosphorylation of LRRK2 by casein kinase 1alpha regulates trans-Golgi clustering via differential interaction with ARHGEF7. PMID: 25500533
  9. GIT1/betaPIX/Rac1/PAK pathway plays a crucial role in regulating GABA(A)R synaptic stability and hence inhibitory synaptic transmission with important implications for inhibitory plasticity and information processing in the brain. PMID: 25284783
  10. Conversely, increased expression of betaPIX in breast cancer cell lines re-couples the Hippo kinase cassette to Yap/Taz, promoting localization of Yap/Taz to the cytoplasm and inhibiting cell migration and proliferation. PMID: 25425573
  11. Data indicate that suppression of c-Cbl protein by rho guanine nucleotide exchange factor 7 (Cool-1) may be critical for generation of at least a subset of glioblastoma (GBM). PMID: 24458840
  12. The interaction of betaPix with srGAP1 is critical for maintaining suppressive crosstalk between Cdc42 and RhoA during 3D collagen migration. PMID: 25150978
  13. BetaPix phosphorylation at Ser-340 upregulates Nox1 through Rac activation. PMID: 24792722
  14. It has identified and characterized a novel interaction between CaM and beta-p21-activated kinase interacting exchange factor (beta-PIX), a putative guanine exchange factor implicated in cell signaling. PMID: 22588125
  15. Inhibition of glycogen synthase kinase (GSK)-3beta increases the migration capacity of mesenchymal stromal cells during ex vivo expansion. PMID: 23288365
  16. beta1Pix functions as a transcriptional regulator of beta-catenin signaling through direct interaction with beta-catenin, an action that may be functionally relevant to colon cancer biology. PMID: 24129564
  17. BETA-PIX is a novel downstream signalling mediator during invadopodia formation. PMID: 23740575
  18. In vivo migratory capacity of mesenchymal stromal cells depends upon the expression level of beta-PIX. PMID: 22087847
  19. These defects could be rescued by depletion of ARHGEF7 and p21-activated kinase, Rac1-specific effector proteins required for cell adhesion. PMID: 22945935
  20. a model by which SNX27 regulates trafficking of beta-Pix to focal adhesions and thereby influences cell motility. PMID: 21926430
  21. Results describe the role of beta-Pix in the negative regulation of focal adhesion maturation and the promotion of lamellipodial protrusion and focal adhesion turnover to drive cell migration. PMID: 21423176
  22. Downstream effects of phosphorylation of ARHGEF7 through LRRK2 could be (i) a feedback control mechanism for LRRK2 activity as well as (ii) an impact of LRRK2 on actin cytoskeleton regulation PMID: 21048939
  23. betaPix up-regulates NHE3 membrane expression and activity by Shank2-mediated protein-protein interaction and by activating Rho GTPases in the apical regions of epithelial cells PMID: 20080968
  24. MYO18A is a novel binding partner of the PAK2/betaPIX/GIT1 complex and suggest that MYO18A may play an important role in regulating epithelial cell migration via affecting multiple cell machineries. PMID: 19923322
  25. bFGF- and NGF-induced phosphorylation of p85 betaPIX mediates Rac1 activation, which in turn regulates cytoskeletal reorganization at growth cones, but not translocation of the PIX complex. PMID: 14557270
  26. PIX protein is tightly associated with the GIT family ARF GTPase-activating proteins as a multimeric nexus capable of linking together important signaling molecules. PMID: 15212761
  27. PAK1 recruitment to the T cell-antigen-presenting cell interface required interaction with PIX. PMID: 15864311
  28. These results suggest that the formation of the complex consisting of Nox1, betaPix, and NoxO1 is likely to be a critical step in EGF-induced ROS generation. PMID: 16329988
  29. the SH3 domain of betaPix specifically interacts with a proline-arginine motif (PxxxPR) present within the ubiquitin ligase Cbl and Pak1 kinase. Cdc42/betaPix complex blocks Cbl's ability to downregulate EGFR. PMID: 16407834
  30. Rac1-beta-Pix interaction is required for Rac1 activation by beta-Pix as well as for Rac1-mediated spreading PMID: 16492808
  31. These data strongly suggest that, in addition to the known SAP-interacting kinase Fyn, PIX may be another key player in SAP-mediated T cell activation. PMID: 16983070
  32. Tiam1 and betaPIX mediate OxPAPC-induced Rac activation, cytoskeletal remodeling, and barrier protective response in pulmonary endothelium PMID: 17219408
  33. The association of PLCgamma1 with complexes containing GIT1 and beta-Pix is essential for its role in integrin-mediated cell spreading and motility. As a component of this complex, PLCgamma1 is also involved in the activation of Cdc42 and Rac1. PMID: 17562871
  34. PKA-dependent phosphorylation modulates PIXB activity through 14-3-3-beta binding. PMID: 18160719
  35. mutant betaPIX lacking guanine nucleotide exchange factor activity inhibited lamellipodium formation PMID: 18325335
  36. These results identify p66Shc and FOXO3a as novel partners of beta(1)Pix and represent the first direct evidence of beta(1)Pix in cell proliferation via Erk/p66Shc-dependent and Akt-independent mechanisms. PMID: 18385518
  37. Data show that the Rac1 guanine exchange factor- beta-Pix, localizes to focal contacts in human primary Schwannoma cells. PMID: 18445079
  38. Beta-PIX regulates nitric oxide synthase type 2 (NOD2) trafficking and NOD2-dependent signal transduction in primary human monocytes and cell line THP-1. PMID: 18684957
  39. betaPIX and GIT1 regulate the hepatocyte growth factor-induced and Rac1-dependent membrane transport of WAVE2 and consequently, lamellipodia formation. PMID: 19303398

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

Recently viewed