Recombinant Human Rho Guanine Nucleotide Exchange Factor 7 (ARHGEF7) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-08506P

Greater than 90% as determined by SDS-PAGE.
Recombinant Human Rho Guanine Nucleotide Exchange Factor 7 (ARHGEF7) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-08506P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Rho Guanine Nucleotide Exchange Factor 7 (ARHGEF7) Protein (GST) is produced by our E.coli expression system. This is a protein fragment. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | Q14155 |
Target Symbol | ARHGEF7 |
Synonyms | ARHG7; ARHG7_HUMAN; ARHGEF 7; Arhgef7; Beta pix; Beta-Pix; betaPix; betaPix-b; betaPix-c; Cool; COOL-1; COOL1; DKFZp686C12170; DKFZp761K1021; KIAA0142; KIAA0412; mKIAA0142; Nbla10314; P50; P50BP; p85; P85COOL1; P85SPR; PAK interacting exchange factor beta; PAK-interacting exchange factor beta; PAK3; Pak3bp; PIX; PIXB; Rho guanine nucleotide exchange factor (GEF) 7; Rho guanine nucleotide exchange factor (GEF) 7b; Rho guanine nucleotide exchange factor (GEF7); Rho guanine nucleotide exchange factor 7; SH3 domain containing proline rich protein |
Species | Homo sapiens (Human) |
Expression System | E.coli |
Tag | N-GST |
Target Protein Sequence | MTDNSNNQLVVRAKFNFQQTNEDELSFSKGDVIHVTRVEEGGWWEGTLNGRTGWFPSNYVREVKASEKPVSPKSGTLKSPPKGFDTTAINKSYYNVVLQNILETENEYSKELQTVLSTYLRPLQTSEKLSSANISYLMGNLEEICSFQQMLVQSLEECTKLPEAQQRVGGCFLNLMPQMKTLYLTYCANHPSAVNVLTEHSEELGEFMETKGASSPGILVLTTGLSKPFMRLDKYPTLLKELERHMEDYH |
Expression Range | 179-428aa |
Protein Length | Partial |
Mol. Weight | 55.3kDa |
Research Area | Neuroscience |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Acts as a RAC1 guanine nucleotide exchange factor (GEF) and can induce membrane ruffling. Functions in cell migration, attachment and cell spreading. Promotes targeting of RAC1 to focal adhesions. May function as a positive regulator of apoptosis. Downstream of NMDA receptors and CaMKK-CaMK1 signaling cascade, promotes the formation of spines and synapses in hippocampal neurons. |
Subcellular Location | Cell junction, focal adhesion. Cell projection, ruffle. Cytoplasm, cell cortex. Cell projection, lamellipodium. Note=Detected at cell adhesions. A small proportion is detected at focal adhesions. |
Database References | HGNC: 15607 OMIM: 605477 KEGG: hsa:8874 STRING: 9606.ENSP00000364893 UniGene: PMID: 28596238 |