Recombinant Human Rho Guanine Nucleotide Exchange Factor 7 (ARHGEF7) Protein (GST)

Beta LifeScience SKU/CAT #: BLC-08506P
Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SDS-PAGE.

Recombinant Human Rho Guanine Nucleotide Exchange Factor 7 (ARHGEF7) Protein (GST)

Beta LifeScience SKU/CAT #: BLC-08506P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Human Rho Guanine Nucleotide Exchange Factor 7 (ARHGEF7) Protein (GST) is produced by our E.coli expression system. This is a protein fragment.
Purity Greater than 90% as determined by SDS-PAGE.
Uniprotkb Q14155
Target Symbol ARHGEF7
Synonyms ARHG7; ARHG7_HUMAN; ARHGEF 7; Arhgef7; Beta pix; Beta-Pix; betaPix; betaPix-b; betaPix-c; Cool; COOL-1; COOL1; DKFZp686C12170; DKFZp761K1021; KIAA0142; KIAA0412; mKIAA0142; Nbla10314; P50; P50BP; p85; P85COOL1; P85SPR; PAK interacting exchange factor beta; PAK-interacting exchange factor beta; PAK3; Pak3bp; PIX; PIXB; Rho guanine nucleotide exchange factor (GEF) 7; Rho guanine nucleotide exchange factor (GEF) 7b; Rho guanine nucleotide exchange factor (GEF7); Rho guanine nucleotide exchange factor 7; SH3 domain containing proline rich protein
Species Homo sapiens (Human)
Expression System E.coli
Tag N-GST
Target Protein Sequence MTDNSNNQLVVRAKFNFQQTNEDELSFSKGDVIHVTRVEEGGWWEGTLNGRTGWFPSNYVREVKASEKPVSPKSGTLKSPPKGFDTTAINKSYYNVVLQNILETENEYSKELQTVLSTYLRPLQTSEKLSSANISYLMGNLEEICSFQQMLVQSLEECTKLPEAQQRVGGCFLNLMPQMKTLYLTYCANHPSAVNVLTEHSEELGEFMETKGASSPGILVLTTGLSKPFMRLDKYPTLLKELERHMEDYH
Expression Range 179-428aa
Protein Length Partial
Mol. Weight 55.3kDa
Research Area Neuroscience
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Acts as a RAC1 guanine nucleotide exchange factor (GEF) and can induce membrane ruffling. Functions in cell migration, attachment and cell spreading. Promotes targeting of RAC1 to focal adhesions. May function as a positive regulator of apoptosis. Downstream of NMDA receptors and CaMKK-CaMK1 signaling cascade, promotes the formation of spines and synapses in hippocampal neurons.
Subcellular Location Cell junction, focal adhesion. Cell projection, ruffle. Cytoplasm, cell cortex. Cell projection, lamellipodium. Note=Detected at cell adhesions. A small proportion is detected at focal adhesions.
Database References

HGNC: 15607

OMIM: 605477

KEGG: hsa:8874

STRING: 9606.ENSP00000364893

UniGene: PMID: 28596238

  • S340E mutation enhances Nox1 activation (Kaito et al., 2014), the present study suggests that betaPix can also play an inhibitory role in O2(-) production, depending on the sites of phosphorylation. PMID: 29242061
  • Data suggest that Scribble PDZ-domain-1 and PDZ-domain-3 are major domains that interact with beta-PIX and exhibit distinct binding hierarchy in interactions between individual Scribble PDZ domains and beta-PIX. (Scribble = scribbled planar cell polarity protein; beta-PIX = Rho guanine nucleotide exchange factor 7) PMID: 29061852
  • each mutation in LRRK2 and ARHGEF7 demonstrated its unique functional property, which may contribute to the pathogenesis of Parkinson disease PMID: 27423549
  • we discuss recent findings in key physiological systems that exemplify current understanding of the function of this important regulatory complex. Further, we draw attention to gaps in crucial information that remain to be filled to allow a better understanding of the many roles of the GIT-PIX complex in health and disease PMID: 27182061
  • Data show association of G protein-coupled receptor kinase-interacting protein 1 (GIT1), p21-activated kinase interacting exchange factor (betaPIX), and p21 protein (Cdc42/Rac)-activated kinase 1 (PAK1) with centrosomes. PMID: 27012601
  • Data show the role of Rho guanine nucleotide exchange factor 7 (beta-PIX) to the regulation of high mobility of lung adenocarcinoma cell line H1299 via regulation of focal adhesions dynamics, changes in actin cytoskeleton organization and cell polarity. PMID: 25683605
  • Phosphorylation of LRRK2 by casein kinase 1alpha regulates trans-Golgi clustering via differential interaction with ARHGEF7. PMID: 25500533
  • GIT1/betaPIX/Rac1/PAK pathway plays a crucial role in regulating GABA(A)R synaptic stability and hence inhibitory synaptic transmission with important implications for inhibitory plasticity and information processing in the brain. PMID: 25284783
  • Conversely, increased expression of betaPIX in breast cancer cell lines re-couples the Hippo kinase cassette to Yap/Taz, promoting localization of Yap/Taz to the cytoplasm and inhibiting cell migration and proliferation. PMID: 25425573
  • Data indicate that suppression of c-Cbl protein by rho guanine nucleotide exchange factor 7 (Cool-1) may be critical for generation of at least a subset of glioblastoma (GBM). PMID: 24458840
  • The interaction of betaPix with srGAP1 is critical for maintaining suppressive crosstalk between Cdc42 and RhoA during 3D collagen migration. PMID: 25150978
  • BetaPix phosphorylation at Ser-340 upregulates Nox1 through Rac activation. PMID: 24792722
  • It has identified and characterized a novel interaction between CaM and beta-p21-activated kinase interacting exchange factor (beta-PIX), a putative guanine exchange factor implicated in cell signaling. PMID: 22588125
  • Inhibition of glycogen synthase kinase (GSK)-3beta increases the migration capacity of mesenchymal stromal cells during ex vivo expansion. PMID: 23288365
  • beta1Pix functions as a transcriptional regulator of beta-catenin signaling through direct interaction with beta-catenin, an action that may be functionally relevant to colon cancer biology. PMID: 24129564
  • BETA-PIX is a novel downstream signalling mediator during invadopodia formation. PMID: 23740575
  • In vivo migratory capacity of mesenchymal stromal cells depends upon the expression level of beta-PIX. PMID: 22087847
  • These defects could be rescued by depletion of ARHGEF7 and p21-activated kinase, Rac1-specific effector proteins required for cell adhesion. PMID: 22945935
  • a model by which SNX27 regulates trafficking of beta-Pix to focal adhesions and thereby influences cell motility. PMID: 21926430
  • Results describe the role of beta-Pix in the negative regulation of focal adhesion maturation and the promotion of lamellipodial protrusion and focal adhesion turnover to drive cell migration. PMID: 21423176
  • Downstream effects of phosphorylation of ARHGEF7 through LRRK2 could be (i) a feedback control mechanism for LRRK2 activity as well as (ii) an impact of LRRK2 on actin cytoskeleton regulation PMID: 21048939
  • betaPix up-regulates NHE3 membrane expression and activity by Shank2-mediated protein-protein interaction and by activating Rho GTPases in the apical regions of epithelial cells PMID: 20080968
  • MYO18A is a novel binding partner of the PAK2/betaPIX/GIT1 complex and suggest that MYO18A may play an important role in regulating epithelial cell migration via affecting multiple cell machineries. PMID: 19923322
  • bFGF- and NGF-induced phosphorylation of p85 betaPIX mediates Rac1 activation, which in turn regulates cytoskeletal reorganization at growth cones, but not translocation of the PIX complex. PMID: 14557270
  • PIX protein is tightly associated with the GIT family ARF GTPase-activating proteins as a multimeric nexus capable of linking together important signaling molecules. PMID: 15212761
  • PAK1 recruitment to the T cell-antigen-presenting cell interface required interaction with PIX. PMID: 15864311
  • These results suggest that the formation of the complex consisting of Nox1, betaPix, and NoxO1 is likely to be a critical step in EGF-induced ROS generation. PMID: 16329988
  • the SH3 domain of betaPix specifically interacts with a proline-arginine motif (PxxxPR) present within the ubiquitin ligase Cbl and Pak1 kinase. Cdc42/betaPix complex blocks Cbl's ability to downregulate EGFR. PMID: 16407834
  • Rac1-beta-Pix interaction is required for Rac1 activation by beta-Pix as well as for Rac1-mediated spreading PMID: 16492808
  • These data strongly suggest that, in addition to the known SAP-interacting kinase Fyn, PIX may be another key player in SAP-mediated T cell activation. PMID: 16983070
  • Tiam1 and betaPIX mediate OxPAPC-induced Rac activation, cytoskeletal remodeling, and barrier protective response in pulmonary endothelium PMID: 17219408
  • The association of PLCgamma1 with complexes containing GIT1 and beta-Pix is essential for its role in integrin-mediated cell spreading and motility. As a component of this complex, PLCgamma1 is also involved in the activation of Cdc42 and Rac1. PMID: 17562871
  • PKA-dependent phosphorylation modulates PIXB activity through 14-3-3-beta binding. PMID: 18160719
  • mutant betaPIX lacking guanine nucleotide exchange factor activity inhibited lamellipodium formation PMID: 18325335
  • These results identify p66Shc and FOXO3a as novel partners of beta(1)Pix and represent the first direct evidence of beta(1)Pix in cell proliferation via Erk/p66Shc-dependent and Akt-independent mechanisms. PMID: 18385518
  • Data show that the Rac1 guanine exchange factor- beta-Pix, localizes to focal contacts in human primary Schwannoma cells. PMID: 18445079
  • Beta-PIX regulates nitric oxide synthase type 2 (NOD2) trafficking and NOD2-dependent signal transduction in primary human monocytes and cell line THP-1. PMID: 18684957
  • betaPIX and GIT1 regulate the hepatocyte growth factor-induced and Rac1-dependent membrane transport of WAVE2 and consequently, lamellipodia formation. PMID: 19303398
  • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    Recently viewed