Recombinant Human Rho Gdp-Dissociation Inhibitor 1 (ARHGDIA) Protein (GST)

Name: Recombinant Human Rho Gdp-Dissociation Inhibitor 1 (ARHGDIA) Protein (GST)
Brand: Beta LifeScience
SKU: BLC-03623P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Rho Gdp-Dissociation Inhibitor 1 (ARHGDIA) Protein (GST) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P52565
Target Symbol	ARHGDIA
Synonyms	ARHGDIA; fa96g11; GDIA 1; GDIA1; GDIR1_HUMAN; MGC117248; NPHS8; Rho GDI 1; Rho GDI alpha; Rho GDI; Rho GDP dissociation inhibitor (GDI) alpha ; Rho GDP dissociation inhibitor 1; Rho GDP dissociation inhibitor alpha; Rho GDP-dissociation inhibitor 1; Rho-GDI alpha; RhoGDI 1; RhoGDI alpha; RHOGDI; RhoGDI1; wu:fa96g11; zgc:55554; zgc:77681
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-GST
Target Protein Sequence	AEQEPTAEQLAQIAAENEEDEHSVNYKPPAQKSIQEIQELDKDDESLRKYKEALLGRVAVSADPNVPNVVVTGLTLVCSSAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNREIVSGMKYIQHTYRKGVKIDKTDYMVGSYGPRAEEYEFLTPVEEAPKGMLARGSYSIKSRFTDDDKTDHLSWEWNLTIKKDWKD
Expression Range	2-204aa
Protein Length	Full Length of Mature Protein
Mol. Weight	50.1kDa
Research Area	Signal Transduction
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Controls Rho proteins homeostasis. Regulates the GDP/GTP exchange reaction of the Rho proteins by inhibiting the dissociation of GDP from them, and the subsequent binding of GTP to them. Retains Rho proteins such as CDC42, RAC1 and RHOA in an inactive cytosolic pool, regulating their stability and protecting them from degradation. Actively involved in the recycling and distribution of activated Rho GTPases in the cell, mediates extraction from membranes of both inactive and activated molecules due its exceptionally high affinity for prenylated forms. Through the modulation of Rho proteins, may play a role in cell motility regulation. In glioma cells, inhibits cell migration and invasion by mediating the signals of SEMA5A and PLXNB3 that lead to inactivation of RAC1.
Subcellular Location	Cytoplasm.
Protein Families	Rho GDI family
Database References	HGNC: 678 OMIM: 601925 KEGG: hsa:396 STRING: 9606.ENSP00000269321 UniGene: PMID: 29307615 RhoGDIalpha is involved in the maintenance of glioma stem cells PMID: 27557508 analysis of the Kindlin-2-RhoGDIalpha-Rac1 signaling axis that is critical for regulation of podocyte structure and function in vivo PMID: 28775002 Data suggest that the interaction between PCBP2 and the 3'UTR of the ARHGDIA mRNA may induce a local change in RNA structure that favors subsequent binding of miR-151-5p and miR-16, thus leading to the suppression of ARHGDIA expression. PMID: 26761212 These molecular changes are indicative of long-term premature endothelial dysfunction and provide a mechanistic framework to the epidemiological data showing increased risk of cardiovascular disease at 0.5 Gy. PMID: 28697312 our results suggest that RhoGDIalpha regulate TRF1 and telomere length and may be novel prognostic biomarkers in colorectal cancer PMID: 28417530 Together, our results suggest a role for Ly-GDI in the localized regulation of Rho GTPases in platelets and hypothesize a link between the PKC and Rho GTPase signaling systems in platelet function. PMID: 28148498 MiR-25 is activated by the WNT/beta-catenin signaling pathway, and exerts its pro-metastatic function by directly inhibiting the Rho GDP dissociation inhibitor alpha (RhoGDI1). Downregulation of RhoGDI1 enhances expression of Snail, thereby promoting EMT. PMID: 26460549 RIP2 and RhoGDI bind to p75(NTR) death domain at partially overlapping epitopes with over 100-fold difference in affinity, revealing the mechanism by which RIP2 recruitment displaces RhoGDI upon ligand binding. PMID: 26646181 Downregulation of RhoGDI could be a critical mechanism of breast tumor development, which may involve the hyperactivation of Rho GTPases and upregulation of COX-2 activity. PMID: 26416248 This study showed that ARHGD1A messenger RNA levels was significantly upregulated in subjects with schizophrenia in laminar and cellular samples. PMID: 25981171 RHOGDI alpha acetylation interferes with Rho signaling, resulting in alteration of cellular filamentous actin. PMID: 26719334 the present study has identified loss of ARHGDIA contributed to the processes of hepatic tumorigenesis, in particular invasion and metastasis PMID: 24859471 Results identify a critical role for 14-3-3tau in promoting breast cancer metastasis, in part through binding to and inhibition of RhoGDIalpha, a negative regulator of Rho GTPases and a metastasis suppressor. PMID: 24820414 new mechanistic insights into the understanding of essential role of SUMOylation at Lys-138 in RhoGDIalpha's biological function. PMID: 24342356 A significant trend was identified between loss of RhoGDI expression in hepatocellular carcinoma and worsening clinical prognosis. PMID: 24228117 Our findings suggest that RhoGDI overexpression is a predictor of distant metastasis and plays an important role in the progression of hepatocellular carcinoma PMID: 24374343 the association of RhoGDIalpha with TROY contributed to TROY-dependent RhoA activation and neurite outgrowth inhibition after Nogo-66 stimulation. PMID: 24129566 It was found that the silencing of RhoGDIalpha in MCF7 and MDA-MB-231 cells significantly increased migration and invasion of these cells into the lower surface of porous membrane of the transwell chambers. PMID: 23563506 GDIalpha suppresses AR signaling through inhibition of AR expression, nuclear translocation, and recruitment to androgen-responsive genes. GDIalpha regulatory pathway may play a critical role in regulating AR signaling and prostate cancer growth and progression. PMID: 23922223 we demonstrated the regulation of targeting/accumulation of the RhoGDIalpha-Rac1 complex to phagosomes PMID: 23918979 ARHGDIA mutations (R120X and G173V) from individuals with nephrotic syndrome abrogated interaction with RHO GTPases and increased active GTP-bound RAC1 and CDC42, but not RHOA. PMID: 23867502 Mutations in ARHGDIA need to be considered in the aetiology of heritable forms of nephrotic syndrome. PMID: 23434736 Prenylated and palmitoylated brain Cdc42 did not interact with RhoGDIalpha. PMID: 23358418 Knockdown of RhoGDIalpha induces apoptosis and increases lung cancer cell chemosensitivity to paclitaxel. PMID: 22668020 Rho GDI may be useful as a diagnostic biomarker and/or a therapeutic to prevent colon and prostate cancer metastasis PMID: 22530308 Loss of GDIalpha expression promotes the development and progression of prostate cancer. PMID: 21681778 Both the mRNA and protein expressions of Rho-GDI in the decidual tissues were significantly higher in the normal pregnancy group than in the two severe preeclampsia groups. PMID: 21269984 Data show that knockdown of S100P led to downregulation of thioredoxin 1 and beta-tubulin and upregulation of RhoGDIA, all potential therapeutic targets in cancer. PMID: 21327297 The RhoGDIalpha protein is located in the acrosome and flagellum of human sperm, and might be involved in sperm movement, capacitation and acrosome reaction. PMID: 21548210 We provide evidence that ARHGDIA, COBLL1, and TM4SF1 are negative regulators of apoptosis in cultured tumor cells. PMID: 21569526 Loss of Rho GDIalpha enhances metastasis and resistance to tamoxifen via effects on both ERalpha and MTA2 in models of ERalpha-positive breast cancer and in tumors of tamoxifen-treated patients. PMID: 21447808 The authors show here that the endocytic pathway followed by Clostridium perfringens Iota and Clostridium botulinum C2 toxins is independent of clathrin but requires the activity of dynamin and is regulated by Rho-GDI. PMID: 20846184 A network consisting of ezrin, RhoGDI1, RhoA, F-actin and membrane proteins functions to influence the modifications that occur on the membrane of the sperm head during human sperm capacitation. PMID: 20711218 Data represent a novel signaling of semaphorin 5A and plexin B3 in the control of cell motility by indirect inactivation of Rac1 through RhoGDIalpha. PMID: 20696765 LASP-1, S100A9 and RhoGDI were detected by proteomic analysis to be differentially expressed between normal mucosa, non-metastatic colorectal carcinoma and metastatic CRC tissue PMID: 20812987 The gene ratio test with the COBLL1/ARHGDIA genes for survival of patients with malignant pleural mesothelioma has robust predictive value. PMID: 19401544 PKC phosphorylates RhoGDIalpha on serine 34, resulting in a specific decrease in affinity for RhoA but not Rac1 or Cdc42. PMID: 20472934 Because RhoGDI1 levels are limiting, and Rho proteins compete for binding to RhoGDI1, overexpression of an exogenous Rho GTPase displaces endogenous Rho proteins bound to RhoGDI1, inducing their degradation and inactivation PMID: 20400958 Increased miR-151 expression due to gains on chromosome 8q24.3 can significantly promote hepatocellular carcinoma invasion/metastasis; meanwhile, upregulation of RhoGDIA, a direct and functional target of miR-151, inhibits migration/invasion. PMID: 20305651 Rho-GDIalpha is possibly a useful biomarker to predict the response of breast cancer patients to CMF treatment. PMID: 20043072 analysis of inhibitory and shuttling functions of rhoGDI-3 and rhoGDI-1 PMID: 15513926 These results suggest that Src-mediated RhoGDI phosphorylation is a novel physiological mechanism for regulating Rho GTPase cytosol membrane-cycling and activity. PMID: 16943322 up-regulated in Crohn's disease and ulcerative colitis patients PMID: 17330946 Underexpression of rho GDP dissociation inhibitor alpha is associated with oligodendroglioma PMID: 17653765 In addition to the activity of RhoGDI alpha in the cytoplasm, it also influences ER alpha signaling in the nucleus. PMID: 17909265 Bcr GTPase-activating domain activity is regulated through direct protein/protein interaction with the Rho guanine nucleotide dissociation inhibitor PMID: 18070886 data suggest that RhoGDI may promote colorectal cancer progression and metastasis by stimulating tumor cell growth and migration PMID: 18651761 halothane binds to a site within the geranylgeranyl chain binding pocket of RhoGDIalpha, whereas alcohols bind to a distal site that interacts allosterically with this pocket. PMID: 18702520 Phosphorylation of GTP dissociation inhibitor by PKA negatively regulates RhoA. PMID: 18768928

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.