Recombinant Human RhD Protein
Beta LifeScience
SKU/CAT #: BLA-7779P
Recombinant Human RhD Protein
Beta LifeScience
SKU/CAT #: BLA-7779P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Host Species | Human |
| Synonym | Blood group Rh(D) polypeptide Blood group--Rhesus system D polypeptide CD240D D antigen (DCS) DIIIc MGC165007 RH Rh blood group antigen Evans Rh blood group D antigen Rh polypeptide 2 RH30 Rh4 RHCED Rhd RHD_HUMAN RhDCw RHDel RHDVA(TT) Rhesus blood group D antigen allele DIII type 7 Rhesus D antigen Rhesus system D polypeptide RhII RhK562-II RhPI RHPII RHXIII |
| Description | Recombinant Human RhD Protein was expressed in E.coli. It is a Protein fragment |
| Source | E.coli |
| AA Sequence | ITLFSIRLATMSALSVLISVDAVLGKVNLAQLVVMVLVEVTALGNLRMVI SNIFNTDY |
| Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
| Formulation | Lyophilised |
| Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
| Reconstitution | See related COA |
| Unit Definition | For Research Use Only |
| Storage Buffer | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycle. |
