Recombinant Human Retinol Dehydrogenase 11 (RDH11) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-10224P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Retinol Dehydrogenase 11 (RDH11) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-10224P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Retinol Dehydrogenase 11 (RDH11) Protein (His-SUMO) is produced by our E.coli expression system. This is a cytoplasmic protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | Q8TC12 |
| Target Symbol | RDH11 |
| Synonyms | Androgen regulated short chain dehydrogenase/reductase 1; Androgen-regulated short-chain dehydrogenase/reductase 1; ARSDR1; AU045252; C85936; CGI 82; FLJ32633 ; HCBP12; HCV core binding protein; HCV core binding protein HCBP12; HCV core-binding protein HCBP12; MDT1; Prostate short chain dehydrogenase/reductase 1; Prostate short-chain dehydrogenase/reductase 1; PSDR1; RALR1; RDH11; RDH11_HUMAN; Retinal reductase 1; retinol dehydrogenase 11 (all trans/9 cis/11 cis); Retinol dehydrogenase 11; SCALD; SDR7C1; Short chain dehydrogenase/reductase family 7C; member 1 |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-6His-SUMO |
| Target Protein Sequence | PQIRKMLSSGVCTSTVQLPGKVVVVTGANTGIGKETAKELAQRGARVYLACRDVEKGELVAKEIQTTTGNQQVLVRKLDLSDTKSIRAFAKGFLAEEKHLHVLINNAGVMMCPYSKTADGFEMHIGVNHLGHFLLTHLLLEKLKESAPSRIVNVSSLAHHLGRIHFHNLQGEKFYNAGLAYCHSKLANILFTQELARRLKGSGVTTYSVHPGTVQSELVRHSSFMRWMWWLFSFFIKTPQQGAQTSLHCALTEGLEILSGNHFSDCHVAWVSAQARNETIARRLWDVSCDLLGLPID |
| Expression Range | 22-318aa |
| Protein Length | Cytoplasmic Domain |
| Mol. Weight | 49.0kDa |
| Research Area | Neuroscience |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Retinol dehydrogenase with a clear preference for NADP. Displays high activity towards 9-cis, 11-cis and all-trans-retinol, and to a lesser extent on 13-cis-retinol. Exhibits a low reductive activity towards unsaturated medium-chain aldehydes such as cis -6-nonenal and no activity toward nonanal or 4-hydroxy-nonenal. Has no dehydrogenase activity towards steroid. |
| Subcellular Location | Endoplasmic reticulum membrane; Single-pass type II membrane protein. |
| Protein Families | Short-chain dehydrogenases/reductases (SDR) family |
| Database References | HGNC: 17964 OMIM: 607849 KEGG: hsa:51109 STRING: 9606.ENSP00000370750 UniGene: PMID: 25542782 |
