Recombinant Human Retinoic Acid-Induced Protein 3 (GPRC5A) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-01599P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Retinoic Acid-Induced Protein 3 (GPRC5A) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-01599P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Retinoic Acid-Induced Protein 3 (GPRC5A) Protein (GST) is produced by our E.coli expression system. This is a protein fragment. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | Q8NFJ5 |
| Target Symbol | GPRC5A |
| Synonyms | GPRC5A; GPCR5A; RAI3; RAIG1; Retinoic acid-induced protein 3; G-protein coupled receptor family C group 5 member A; Phorbol ester induced gene 1; PEIG-1; Retinoic acid-induced gene 1 protein; RAIG-1 |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-GST |
| Target Protein Sequence | TKQRNPMDYPVEDAFCKPQLVKKSYGVENRAYSQEEITQGFEETGDTLYAPYSTHFQLQNQPPQKEFSIPRAHAWPSPYKDYEVKKEGS |
| Expression Range | 269-357aa |
| Protein Length | Partial |
| Mol. Weight | 37.0 kDa |
| Research Area | Neuroscience |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Orphan receptor. Could be involved in modulating differentiation and maintaining homeostasis of epithelial cells. This retinoic acid-inducible GPCR provide evidence for a possible interaction between retinoid and G-protein signaling pathways. Functions as a negative modulator of EGFR signaling. May act as a lung tumor suppressor. |
| Subcellular Location | Cell membrane; Multi-pass membrane protein. Cytoplasmic vesicle membrane; Multi-pass membrane protein. |
| Protein Families | G-protein coupled receptor 3 family |
| Database References | HGNC: 9836 OMIM: 604138 KEGG: hsa:9052 STRING: 9606.ENSP00000014914 UniGene: PMID: 29949874 |
