Recombinant Human Retinoblastoma-Like Protein 2 (RBL2) Protein (His)

Name: Recombinant Human Retinoblastoma-Like Protein 2 (RBL2) Protein (His)
Brand: Beta LifeScience
SKU: BLC-07915P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Product Overview

Description	Recombinant Human Retinoblastoma-Like Protein 2 (RBL2) Protein (His) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	Q08999
Target Symbol	RBL2
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His
Target Protein Sequence	TPVSTATHSLSRLHTMLTGLRNAPSEKLEQILRTCSRDPTQAIANRLKEMFEIYSQHFQPDEDFSNCAKEIASKHFRFAEMLYYKVLESVIEQEQKRLGDMDLSGILEQDAFHRSLLACCLEVVTFSYKPPGNFPFITEIFDVPLYHFYKVIEVFIRAEDGLCREVVKHLNQIEEQILDHLAWKPESPLWEKIRDNENRV
Expression Range	417-616aa
Protein Length	Partial
Mol. Weight	27.4 kDa
Research Area	Cancer
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Key regulator of entry into cell division. Directly involved in heterochromatin formation by maintaining overall chromatin structure and, in particular, that of constitutive heterochromatin by stabilizing histone methylation. Recruits and targets histone methyltransferases KMT5B and KMT5C, leading to epigenetic transcriptional repression. Controls histone H4 'Lys-20' trimethylation. Probably acts as a transcription repressor by recruiting chromatin-modifying enzymes to promoters. Potent inhibitor of E2F-mediated trans-activation, associates preferentially with E2F5. Binds to cyclins A and E. Binds to and may be involved in the transforming capacity of the adenovirus E1A protein. May act as a tumor suppressor.
Subcellular Location	Nucleus.
Protein Families	Retinoblastoma protein (RB) family
Database References	HGNC: 9894 OMIM: 180203 KEGG: hsa:5934 STRING: 9606.ENSP00000262133 UniGene: Hs.513609

Gene Functions References

Three fold reduced Rbl2/p130 expression in these tumor tissues were noticed compared to their control tissues. DNA obtained from MNAse digested chromatin was used as PCR template. PMID: 29417345
Hepatitis C virus core protein modulates pRb2/p130 expression in human hepatocellular carcinoma cell lines through promoter methylation PMID: 26576645
Statistical analysis revealed that Rbl2/p130 expression negatively correlates to its promoter methylation (r = -0.412) in tumor tissues. PMID: 26271034
TGF-beta induced RBL2 expression through down-regulating miR-93 in renal cancer cells PMID: 25183046
expression profiling of miRNAs in high-grade serous ovarian carcinoma indicated miR-106a and its family members were upregulated; findings suggest miR-106a can repress expression of the retinoblastoma family member RBL2 and miR-106a overexpression results in rapid tumor growth and poor differentiation PMID: 24045973
Low expression of RBL2 is associated with glioma. PMID: 23377830
Our hypothesis not only enrich the knowledge of the regulation of ALT, but also indicate that p130 may serve as a potential suppressor of ALT, and gene therapy of p130 may be used in cervical cancers. PMID: 22595804
The results show that continued human papillomavirus 16 E6/E7 expression is necessary in cervical cancer cells to prevent cell-cycle arrest by a repressive p130-DREAM complex. PMID: 21813705
Hypoproliferation and loss of differentiation in organotypic raft cultures of primary neonatal human foreskin keratinocytes depleted of the alpha and beta isoforms of p63 result from p53-p21-mediated accumulation of retinoblastoma (Rb) family member p130. PMID: 21511729
The activity of CTCF in controlling Rb2/p130 gene expression is impaired by BORIS, which by binding to the Rb2/p130 gene could trigger changes in the chromatin asset established by CTCF affecting CTCF regulatory activity on Rb2/p130 transcription. PMID: 21325284
Human papillomavirus E7 protein K39,42R mutation moderately increased the association with and the destabilization of p130. PMID: 21411531
Gsk3beta, p130 and beta-catenin form in MSC a complex the functional role of which may be associated with activation of differentiation not coupled to cell cycle arrest. PMID: 21516817
heterogeneous RB (pRb2 or p16) and p53 (p53, p14, or p21) pathway alterations occur frequently in Burkitt lymphoma PMID: 21127431
Loss of p130 accelerates tumor development in a mouse model for human small-cell lung carcinoma. PMID: 20406986
FTO influence RBL2 gene expression at large genetic distances PMID: 20009087
Data suggest that KSHV miRNA targets multiple pathways to maintain KHSV latency, including repression of the viral protein Rta and a cellular factor, Rbl2, and increased cellular DNMT, in regulating global epigenetic reprogramming. PMID: 20071580
The half-life of p130, relative to control cells, was decreased in the cytoplasm in the presence of human papillomavirus 6 E7 or human papillomavirus 16 E7, but only decreased by HPV 6 E7 in the nucleus. PMID: 20189212
p130 and its truncated form might substitute Rb in mediating p53-induced cell cycle arrest in Rb(-/-) Saos2 cells PMID: 12386819
p130 turnover is regulated by Cdk-dependent G1 phosphorylation leading to ubiquitin-dependent proteolysis PMID: 12435635
Expression of this gene predicts outcome in squamous cell carcinoma of the esophagus. PMID: 12474056
reduced p130 expression may contribute to the aggressive character of anplastic carcinoma; and p130 may specify the growth characteristics of microcarcinoma PMID: 12637156
We investigated occupancy of ER-alpha promoter by pRb2/p130-E2F4/5-HDAC1-SUV39 H1-p300 and pRb2/p130-E2F4/5-HDAC1-SUV39H1-DNMT1 complexes, and provided a link between pRb2/p130 and chromatin-modifying enzymes in the regulation of ER-alpha transcription PMID: 12789259
Analysis of gene expression level profiles showed that parental cell line undergoes apoptosis through an E2F1/p73-dependent pathway while its drug resistant variant evades it. PMID: 12789260
ATRA mediates growth inhibition by stabilizing Rb2/p130 via a mechanism that involves induction of PP2A, an enzyme that can potentially dephosphorylate Rb2/p130, thereby protecting it from degradation by the proteasome. PMID: 12915404
T Ag recruits a phosphatase activity in a DNA J domain-dependent manner to reduce the phosphorylation of p130 PMID: 12968030
The interaction between HIV-1 tat and Rb2 may be a possible mechanism in the pathogenesis of AIDS-related lymphoma. PMID: 13679860
Rb2/P130 target genes in non-small-cell lung neoplasms are identified by microarray analysis. PMID: 14534545
Reduced transcription of the RB2/p130 gene is associated with lung cancer PMID: 14587097
pRb2/p130 has a role as a tumour suppressor protein in hepatocellular carcinoma PMID: 15059924
pRb2/p130 overexpression is able to arrest cell growth in ovarian carcinoma cells, suggesting the putative role of pRb2/p130 as a tumor suppressor in this malignancy. PMID: 15131049
VEGF together with pRb2/p130 may have a role in hepatocellular carcinoma in a p27((KIP1))-independent manner PMID: 15161709
Disruption of E2F4 through small interfering RNA prevented p130/E2F4 complex formation and sensitized prostate cancer cells to IR-induced apoptosis. PMID: 15231644
Rb2/ p130 expression can additionally be an indicator of a better prognosis in patients with gliomas PMID: 15696973
RBP2 resembles other chromatin-associated transcriptional regulators and RBP2 binding to activate transcription and promote differentiation. PMID: 15949438
p130 is a trancriptional regulator of the cell cycle genes. PMID: 16135806
Involved in progression and regulation of telomerase PMID: 16364039
ER-beta and pRb2/p130 proteins co-immunoprecipitate in both nucleus and cytoplasm of MCF-7 breast cancer cells. The interaction of pRb2/130 with ER-beta may have a functional significance in regulating ER-beta activity. PMID: 16760287
All-trans-retinoic acid (ATRA) has been shown to arrest the growth of ovarian carcinoma cells in G0/G1 and to significantly elevate levels of Rb2/p130 protein. (review) PMID: 16936753
supportive role in the genesis of retinoblastoma has recently been proposed for the RB1-related gene RB2/p130. (review) PMID: 16936755
Mutated RBL2 is associated with Burkitt lymphoma PMID: 17485552
Evolutionarily conserved multisubunit protein complex that contains p130 and E2F4 mediates the repression of cell cycle-dependent genes in quiescence. PMID: 17531812
no mutation of p53 and RB2/p130 genes was identified in any of the blood samples from Malaysian nasopharyngeal carcinoma PMID: 17694957
There was a strong correlation between the expression of p130 in Stage 1 & 3, but not Stage 2, tumors. High levels of p130 were detected in the cytoplasm rather than the nucleus, suggesting an aberrant subcellular localization of this tumor suppressor. PMID: 17905135
Collectively, these data support the notion that p130 controls the homeostasis of the differentiated keratinocytes and is therefore targeted by E7 for degradation to establish conditions permissive for viral DNA amplification. PMID: 18321970
P130 may be required to prevent the onset of terminal growth arrest in unstimulated prostate cancer cells lacking a functional Rb allele. PMID: 18418057
It is possible that a hyperphosphorylated form of Rb2/p130 may contribute to the resistance of ovarian carcinoma cells to ATRA mediated growth suppression PMID: 18446820
pRb2/p130 has a role in reducing survival in human soft tissue sarcomas PMID: 18676747
Loss of heterozygosity within RBL2/p130 gene is associated with retinoblastoma. PMID: 19252413
pRb2/p130 was mainly localized in the cytoplasm rather than in the nucleus in rectal cancer. PMID: 19597825
Data suggest that Rb2/p130 is a member of the p53-p21 DNA damage signaling cascade, and represents the essential pocket protein family member needed for the induction of any type of senescence. PMID: 19648966

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.