Recombinant Human Retinal Dehydrogenase 2 (ALDH1A2) Protein (His)

Name: Recombinant Human Retinal Dehydrogenase 2 (ALDH1A2) Protein (His)
Brand: Beta LifeScience
SKU: BLC-03303P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Retinal Dehydrogenase 2 (ALDH1A2) Protein (His) is produced by our Yeast expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	O94788
Target Symbol	ALDH1A2
Synonyms	AL1A2_HUMAN; Aldehyde dehydrogenase family 1 member A2; ALDH1A2 aldehyde dehydrogenase 1 family; member A2 ; ALDH1A2; Aldh1a7; AV116159; MGC26444; RALDH 2; RALDH(II); Raldh1; RalDH2; RALDH2 T; Retinal dehydrogenase 2; Retinaldehyde dehydrogenase 2 ; Retinaldehyde specific dehydrogenase type 2; Retinaldehyde-specific dehydrogenase type 2
Species	Homo sapiens (Human)
Expression System	Yeast
Tag	N-6His
Target Protein Sequence	MTSSKIEMPGEVKADPAALMASLHLLPSPTPNLEIKYTKIFINNEWQNSESGRVFPVYNPATGEQVCEVQEADKADIDKAVQAARLAFSLGSVWRRMDASERGRLLDKLADLVERDRAVLATMESLNGGKPFLQAFYVDLQGVIKTFRYYAGWADKIHGMTIPVDGDYFTFTRHEPIGVCGQIIPWNFPLLMFAWKIAPALCCGNTVVIKPAEQTPLSALYMGALIKEAGFPPGVINILPGYGPTAGAAIASHIGIDKIAFTGSTEVGKLIQEAAGRSNLKRVTLELGGKSPNIIFADADLDYAVEQAHQGVFFNQGQCCTAGSRIFVEESIYEEFVRRSVERAKRRVVGSPFDPTTEQGPQIDKKQYNKILELIQSGVAEGAKLECGGKGLGRKGFFIEPTVFSNVTDDMRIAKEEIFGPVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALTVSSAMQAGTVWINCYNALNAQSPFGGFKMSGNGREMGEFGLREYSEVKTVTVKIPQKNS
Expression Range	1-518aa
Protein Length	Full Length
Mol. Weight	58.7kDa
Research Area	Neuroscience
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Converts retinaldehyde to retinoic acid. Recognizes as substrates free retinal and cellular retinol-binding protein-bound retinal. Can metabolize octanal and decanal, but has only very low activity with benzaldehyde, acetaldehyde and propanal. Displays complete lack of activity with citral.
Subcellular Location	Cytoplasm.
Protein Families	Aldehyde dehydrogenase family
Database References	HGNC: 15472 OMIM: 603687 KEGG: hsa:8854 STRING: 9606.ENSP00000249750 UniGene: PMID: 28089900 high transcription activities of ALDH1A2, ALDH1A3 and ALDH1L1 predicted worsen overall survival in gastric cancer patients PMID: 27015121 Data show that hRALDH2 is not inhibited by its oxidation product, all-trans-RA, suggesting the absence of a negative feedback regulatory loop. Expression of the Raldh2 gene is known to be regulated by RA itself, suggesting that the main regulation of the hRALDH2 activity level is transcriptional. PMID: 27001866 Study shows no evidence that genetic variants alter prostate cancer incidence, but show that SNPs in the ALDH1A2 gene affect prostate cancer mortality. PMID: 27643404 a critical role of ALDH1A2-RAR signaling in the pathogenesis of head and neck cancer. PMID: 26634247 High expression of ALDH1A2 and ALDH1B1 mRNA was found to be significantly correlated to worser survival in all NSCLC patients. PMID: 26366059 the distribution of RALDH1, RALDH2, and RALDH3 in the postnatal eye was determined. PMID: 25793304 ALDH1A2 is involved in the regulation of cancer stem cell properties in neuroblastoma. PMID: 25524880 At the transcript level, the cisplatin + DEAB-resistant cells showed upregulated mRNA expression levels for ALDH1A2, ALDH1A3 isozymes and CD44 indicating the involvement of these markers in conferring chemoresistance PMID: 24884875 DNA methylation at multiple CpG sites is associated with loss of control over alcohol drinking. PMID: 24236815 Severe osteoarthritis of the hand associates with common variants within the ALDH1A2 gene and with rare variants at 1p31. PMID: 24728293 These findings suggest that ALDH1A2 is the enzyme involved in retinoic acid biosynthesis in human germ cells. PMID: 24524833 all three proteins (RDH10, RALDH2, and CRABP2) appeared to be required for ATRA production induced by activation of PPARgamma PMID: 23833249 ALDH1A2 protein was effective in AraC resistance. ALDH1A2 knock-down induced sensitivity to AraC treatment in K562AC cells. ALDH1A2 overexpressed K562S cells acquired the AraC resistance. Ara-C-resistant patients had increased ALDH1A2. PMID: 23507523 In vivo reduction of vitamin A levels results in an increase in astrocyte RALDH2 expression in the hippocampus. PMID: 22930583 Aberrant methylation of ALDH1a2 gene is the main cause for gene transcriptional inactivation in human bladder cancer cell lines. 5-Aza-2'-deoxycitydine or trichostatin A treatment induces ALDH1a2 expression. PMID: 20450613 A human ALDH1A2 gene variant is associated with increased newborn kidney size and serum retinoic acid. PMID: 20375987 Individual variation in ALDH1A2/CRABP2 genes may account for subtle variations in retinoic acid-dependent human embryogenesis. PMID: 20308937 The results of this study suggested a positive association between ALDH1A2 and schizophrenics in the Chinese population and support the retinoid hypothesis of schizophrenia. PMID: 19703508 polymorphisms in ALDH1A2 may influence the risk for lumbosacral myelomeningocele PMID: 16237707 Raldh2-/- knockout embryos exhibit defective morphogenesis of various forebrain derivatives, including the ventral diencephalon, the optic and telencephalic vesicles. PMID: 16368932 Gene duplication event that gave rise to Aldh1a1 and Aldh1a2 was more recent than the duplication event that gave rise to Aldh1a3. PMID: 19478994 our screen indicates that ALDH1A2 genetic variation is present in tetralogy of Fallot patients, suggesting a possible causal role for this gene in rare cases of human congenital heart disease PMID: 19886994

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.