Recombinant Human Reticulocalbin-1 (RCN1) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-03216P

Greater than 90% as determined by SDS-PAGE.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) RCN1.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) RCN1.
Recombinant Human Reticulocalbin-1 (RCN1) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-03216P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Reticulocalbin-1 (RCN1) Protein (His) is produced by our Yeast expression system. This is a protein fragment. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | Q15293 |
Target Symbol | RCN1 |
Synonyms | Epididymis secretory protein Li 84; FLJ37041; HEL S 84; PIG20; Proliferation inducing gene 20; RCAL; RCN 1; RCN; rcn1; RCN1_HUMAN; Reticulocalbin 1; Reticulocalbin 1 EF hand calcium binding domain; Reticulocalbin-1; Reticulocalbin1 |
Species | Homo sapiens (Human) |
Expression System | Yeast |
Tag | N-6His |
Target Protein Sequence | PTVRKERVVRPDSELGERPPEDNQSFQYDHEAFLGKEDSKTFDQLTPDESKERLGKIVDRIDNDGDGFVTTEELKTWIKRVQKRYIFDNVAKVWKDYDRDKDDKISWEEYKQATYGYYLGNPAEFHDSSDHHTFKKMLPRDERRFKAADLNGDLTATREEFTAFLHPEEFEHMKEIVVLETLEDIDKNGDGFVDQDEYIADMFSHEENGPEPDWVLSEREQFNEFRDLNKDGKLDKDEIRHWILPQDYDHAQAEARHLVYESDKNKDEKLTKEEILENWNMFVGSQATNYGEDLTKNHDEL |
Expression Range | 31-331aa |
Protein Length | Partial |
Mol. Weight | 37.7kDa |
Research Area | Neuroscience |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | May regulate calcium-dependent activities in the endoplasmic reticulum lumen or post-ER compartment. |
Subcellular Location | Endoplasmic reticulum lumen. |
Protein Families | CREC family |
Database References | HGNC: 9934 OMIM: 602735 KEGG: hsa:5954 STRING: 9606.ENSP00000054950 UniGene: PMID: 29453900 |