Recombinant Human Respiratory Syncytial Virus A Major Surface Glycoprotein G (G) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-08585P
Greater than 85% as determined by SDS-PAGE.
Recombinant Human Respiratory Syncytial Virus A Major Surface Glycoprotein G (G) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-08585P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Respiratory Syncytial Virus A Major Surface Glycoprotein G (G) Protein (His&Myc) is produced by our Baculovirus expression system. This is a protein fragment. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Uniprotkb | P03423 |
Target Symbol | G |
Synonyms | GMajor surface glycoprotein G; Attachment glycoprotein G; Membrane-bound glycoprotein; mG |
Species | Human respiratory syncytial virus A (strain A2) |
Expression System | Baculovirus |
Tag | N-10His&C-Myc |
Target Protein Sequence | HKVTPTTAIIQDATSQIKNTTPTYLTQNPQLGISPSNPSEITSQITTILASTTPGVKSTLQSTTVKTKNTTTTQTQPSKPTTKQRQNKPPSKPNNDFHFEVFNFVPCSICSNNPTCWAICKRIPNKKPGKKTTTKPTKKPTLKTTKKDPKPQTTKSKEVPTTKPTEEPTINTTKTNIITTLLTSNTTGNPELTSQMETFHSTSSEGNPSPSQVSTTSEYPSQPSSPPNTPRQ |
Expression Range | 67-298aa |
Protein Length | Partial |
Mol. Weight | 29.3 kDa |
Research Area | Others |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Attaches the virion to the host cell membrane by interacting with heparan sulfate, initiating the infection. Interacts with host CX3CR1, the receptor for the CX3C chemokine fractalkine, to modulate the immune response and facilitate infection. Unlike the other paramyxovirus attachment proteins, lacks both neuraminidase and hemagglutinating activities (Probable).; Helps the virus escape antibody-dependent restriction of replication by acting as an antigen decoy and by modulating the activity of leukocytes bearing Fc-gamma receptors. |
Subcellular Location | [Isoform Membrane-bound glycoprotein G]: Virion membrane; Single-pass type II membrane protein. Host cell membrane; Single-pass type II membrane protein.; [Isoform Secreted glycoprotein G]: Secreted. |
Protein Families | Pneumoviruses glycoprotein G family |