Recombinant Human Resistin-Like Beta (RETNLB) Protein (His)

Beta LifeScience SKU/CAT #: BLC-10345P
Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SDS-PAGE.

Recombinant Human Resistin-Like Beta (RETNLB) Protein (His)

Beta LifeScience SKU/CAT #: BLC-10345P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Human Resistin-Like Beta (RETNLB) Protein (His) is produced by our Yeast expression system. This is a full length protein.
Purity Greater than 90% as determined by SDS-PAGE.
Uniprotkb Q9BQ08
Target Symbol RETNLB
Synonyms C/EBP epsilon regulated myeloid specific secreted cysteine rich protein precursor 2; CCGR; Colon and small intestine specific cysteine rich protein; Colon and small intestine-specific cysteine-rich protein; Colon carcinoma related gene protein; Colon carcinoma-related gene protein; Cysteine rich secreted A12 alpha like protein 1; Cysteine rich secreted protein A12 alpha like 1; Cysteine rich secreted protein FIZZ2; Cysteine-rich secreted protein A12-alpha-like 1; Cysteine-rich secreted protein FIZZ2; FIZZ1; FIZZ2; Found in inflammatory zone 1; HXCP2; RELM beta; RELMb; RELMbeta; Resistin like beta; Resistin like protein beta; Resistin-like beta; RETNB_HUMAN; RETNL2; Retnlb; XCP2
Species Homo sapiens (Human)
Expression System Yeast
Tag N-6His
Target Protein Sequence QCSLDSVMDKKIKDVLNSLEYSPSPISKKLSCASVKSQGRPSSCPAGMAVTGCACGYGCGSWDVQLETTCHCQCSVVDWTTARCCHLT
Expression Range 24-111aa
Protein Length Full Length of Mature Protein
Mol. Weight 11.4kDa
Research Area Signal Transduction
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Probable hormone.
Subcellular Location Secreted.
Protein Families Resistin/FIZZ family
Database References

HGNC: 20388

OMIM: 605645

KEGG: hsa:84666

STRING: 9606.ENSP00000295755

UniGene: PMID: 28801998

  • RELMbeta-overexpression can facilitate invasion and migration of gastric carcinoma cells. PMID: 27001185
  • RELMbeta levels were increased in Abdominal aortic aneurysm patients in the serum and in the aortic tissue. Increased RELMbeta levels may be involved in the pathogenesis of AAA formation and progress. PMID: 25479529
  • The data demonstrated that RELM-a is a promising novel biomarker of angiogenesis in patients with gastric cancer. PMID: 25937206
  • elevated RELM-beta expression in asthmatic airways contributes to airways remodelling at least partly by increasing fibroblast proliferation and differentiation with resulting deposition of extracellular matrix proteins. PMID: 25545115
  • It is concluded that proper exercise training prevents up-regulation of FIZZ1/RELMalpha induced by cigarette smoking, which may be involved in the mechanism of proper exercise training modulating airway hyperresponsiveness. PMID: 23392702
  • RELMbeta is abundantly expressed in foam cells within plaques and contributes to atherosclerosis development via lipid accumulation and inflammatory facilitation. PMID: 23702657
  • Epithelial cell derived Fizz1 transgene is sufficient to increase bone-marrow derived dendritic cells in the lungs. PMID: 22726462
  • RELM-beta may play an important role not only in animal models of airway remodelling, but also in human airway pathology. PMID: 22758223
  • RELM-beta has the potential to contribute to airway remodelling in diseases such as asthma by acting on epithelial cells to increase proliferation, mucin and growth factor production, at least partly via ERK/MAPK-PI3K/Akt signalling pathways. PMID: 21828035
  • Data show that over-expression of RELMbeta abolishes the invasion, metastasis and angiogenesis of gastric cancer cells in vitro. PMID: 22371635
  • High RELMbeta is associated with colorectal cancer. PMID: 21094111
  • FIZZ2 is highly induced in lungs of human patients with idiopathic pulmonary fibrosis. PMID: 21602491
  • Gastric cncer patients showing positive RELMbeta expression had a significantly longer overall survival than those with negative expression (P = 0.001). PMID: 19967544
  • High levels of RELMbeta can be detected in the stool of mice and humans, where it exists as a homodimer under nonreducing conditions. PMID: 14598255
  • Of the 80 colon cancer patients studied, 65 (81.25%) tested positive for RELM beta, mainly in the cytoplasm of colon mucosa. PMID: 18594973
  • Results suggest that RELM-beta may be involved in the development of scleroderma-associated pulmonary hypertension. PMID: 19251945
  • Supernatant from COS cells transfected with the CCRG (RETNLB) expression vector stimulated proliferation of colon cancer cells, which supports the growth factor nature of the RETNLB gene. PMID: 12224133
  • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    Recently viewed