Recombinant Human Resistin-Like Beta (RETNLB) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-03723P

Greater than 90% as determined by SDS-PAGE.
Recombinant Human Resistin-Like Beta (RETNLB) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-03723P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Resistin-Like Beta (RETNLB) Protein (His) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | Q9BQ08 |
Target Symbol | RETNLB |
Synonyms | C/EBP epsilon regulated myeloid specific secreted cysteine rich protein precursor 2; CCGR; Colon and small intestine specific cysteine rich protein; Colon and small intestine-specific cysteine-rich protein; Colon carcinoma related gene protein; Colon carcinoma-related gene protein; Cysteine rich secreted A12 alpha like protein 1; Cysteine rich secreted protein A12 alpha like 1; Cysteine rich secreted protein FIZZ2; Cysteine-rich secreted protein A12-alpha-like 1; Cysteine-rich secreted protein FIZZ2; FIZZ1; FIZZ2; Found in inflammatory zone 1; HXCP2; RELM beta; RELMb; RELMbeta; Resistin like beta; Resistin like protein beta; Resistin-like beta; RETNB_HUMAN; RETNL2; Retnlb; XCP2 |
Species | Homo sapiens (Human) |
Expression System | E.coli |
Tag | N-6His |
Target Protein Sequence | QCSLDSVMDKKIKDVLNSLEYSPSPISKKLSCASVKSQGRPSSCPAGMAVTGCACGYGCGSWDVQLETTCHCQCSVVDWTTARCCHLT |
Expression Range | 24-111aa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 13.4kDa |
Research Area | Others |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Probable hormone. |
Subcellular Location | Secreted. |
Protein Families | Resistin/FIZZ family |
Database References | |
Tissue Specificity | Expressed only in the gastrointestinal tract, particularly the colon. |
Gene Functions References
- The human mesangial cells with up-regulated and down-regulated expression of RELM-beta increased or decreased significantly at 2-3 days. PMID: 28801998
- RELMbeta-overexpression can facilitate invasion and migration of gastric carcinoma cells. PMID: 27001185
- RELMbeta levels were increased in Abdominal aortic aneurysm patients in the serum and in the aortic tissue. Increased RELMbeta levels may be involved in the pathogenesis of AAA formation and progress. PMID: 25479529
- The data demonstrated that RELM-a is a promising novel biomarker of angiogenesis in patients with gastric cancer. PMID: 25937206
- elevated RELM-beta expression in asthmatic airways contributes to airways remodelling at least partly by increasing fibroblast proliferation and differentiation with resulting deposition of extracellular matrix proteins. PMID: 25545115
- It is concluded that proper exercise training prevents up-regulation of FIZZ1/RELMalpha induced by cigarette smoking, which may be involved in the mechanism of proper exercise training modulating airway hyperresponsiveness. PMID: 23392702
- RELMbeta is abundantly expressed in foam cells within plaques and contributes to atherosclerosis development via lipid accumulation and inflammatory facilitation. PMID: 23702657
- Epithelial cell derived Fizz1 transgene is sufficient to increase bone-marrow derived dendritic cells in the lungs. PMID: 22726462
- RELM-beta may play an important role not only in animal models of airway remodelling, but also in human airway pathology. PMID: 22758223
- RELM-beta has the potential to contribute to airway remodelling in diseases such as asthma by acting on epithelial cells to increase proliferation, mucin and growth factor production, at least partly via ERK/MAPK-PI3K/Akt signalling pathways. PMID: 21828035
- Data show that over-expression of RELMbeta abolishes the invasion, metastasis and angiogenesis of gastric cancer cells in vitro. PMID: 22371635
- High RELMbeta is associated with colorectal cancer. PMID: 21094111
- FIZZ2 is highly induced in lungs of human patients with idiopathic pulmonary fibrosis. PMID: 21602491
- Gastric cncer patients showing positive RELMbeta expression had a significantly longer overall survival than those with negative expression (P = 0.001). PMID: 19967544
- High levels of RELMbeta can be detected in the stool of mice and humans, where it exists as a homodimer under nonreducing conditions. PMID: 14598255
- Of the 80 colon cancer patients studied, 65 (81.25%) tested positive for RELM beta, mainly in the cytoplasm of colon mucosa. PMID: 18594973
- Results suggest that RELM-beta may be involved in the development of scleroderma-associated pulmonary hypertension. PMID: 19251945
- Supernatant from COS cells transfected with the CCRG (RETNLB) expression vector stimulated proliferation of colon cancer cells, which supports the growth factor nature of the RETNLB gene. PMID: 12224133