Recombinant Human Resistin-Like Beta (RETNLB) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-03723P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Resistin-Like Beta (RETNLB) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-03723P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Resistin-Like Beta (RETNLB) Protein (His) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | Q9BQ08 |
| Target Symbol | RETNLB |
| Synonyms | C/EBP epsilon regulated myeloid specific secreted cysteine rich protein precursor 2; CCGR; Colon and small intestine specific cysteine rich protein; Colon and small intestine-specific cysteine-rich protein; Colon carcinoma related gene protein; Colon carcinoma-related gene protein; Cysteine rich secreted A12 alpha like protein 1; Cysteine rich secreted protein A12 alpha like 1; Cysteine rich secreted protein FIZZ2; Cysteine-rich secreted protein A12-alpha-like 1; Cysteine-rich secreted protein FIZZ2; FIZZ1; FIZZ2; Found in inflammatory zone 1; HXCP2; RELM beta; RELMb; RELMbeta; Resistin like beta; Resistin like protein beta; Resistin-like beta; RETNB_HUMAN; RETNL2; Retnlb; XCP2 |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-6His |
| Target Protein Sequence | QCSLDSVMDKKIKDVLNSLEYSPSPISKKLSCASVKSQGRPSSCPAGMAVTGCACGYGCGSWDVQLETTCHCQCSVVDWTTARCCHLT |
| Expression Range | 24-111aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 13.4kDa |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Probable hormone. |
| Subcellular Location | Secreted. |
| Protein Families | Resistin/FIZZ family |
| Database References | HGNC: 20388 OMIM: 605645 KEGG: hsa:84666 STRING: 9606.ENSP00000295755 UniGene: PMID: 28801998 |
