Recombinant Human Replication Factor C Subunit 1 (RFC1) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-10831P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Replication Factor C Subunit 1 (RFC1) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-10831P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Replication Factor C Subunit 1 (RFC1) Protein (His) is produced by our Yeast expression system. This is a protein fragment. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | P35251 |
| Target Symbol | RFC1 |
| Synonyms | A1 140 kDa subunit; A1; A1 P145 Activator 1 large subunit; Activator 1 140 kDa subunit; Activator 1 large subunit; Activator 1 subunit 1; DNA binding Protein PO GA; DNA-binding protein PO-GA; MHC binding factor beta; MHCBFB; PO GA; RECC1; Replication factor C (activator 1) 1, 145kDa; Replication factor C 140 kDa subunit; Replication factor C; Replication factor C large subunit; Replication factor C subunit 1; Replication factor C1; RF-C 140 kDa subunit; RFC; RFC1; RFC1_HUMAN; RFC140; RFC140 Replication Factor C 140 kDa subunit |
| Species | Homo sapiens (Human) |
| Expression System | Yeast |
| Tag | N-6His |
| Target Protein Sequence | GAENCLEGLIFVITGVLESIERDEAKSLIERYGGKVTGNVSKKTNYLVMGRDSGQSKSDKAAALGTKIIDEDGLLNLIRTMPGKKSKYEIA |
| Expression Range | 402-492aa |
| Protein Length | Partial |
| Mol. Weight | 11.8 kDa |
| Research Area | Epigenetics And Nuclear Signaling |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | The elongation of primed DNA templates by DNA polymerase delta and epsilon requires the action of the accessory proteins PCNA and activator 1. This subunit binds to the primer-template junction. Binds the PO-B transcription element as well as other GA rich DNA sequences. Could play a role in DNA transcription regulation as well as DNA replication and/or repair. Can bind single- or double-stranded DNA.; Interacts with C-terminus of PCNA. 5' phosphate residue is required for binding of the N-terminal DNA-binding domain to duplex DNA, suggesting a role in recognition of non-primer template DNA structures during replication and/or repair. |
| Subcellular Location | Nucleus. |
| Protein Families | Activator 1 large subunit family |
| Database References | HGNC: 9969 OMIM: 102579 KEGG: hsa:5981 STRING: 9606.ENSP00000371321 UniGene: PMID: 28199690 |
