Recombinant Human Renin Receptor (ATP6AP2) Protein (His)

Name: Recombinant Human Renin Receptor (ATP6AP2) Protein (His)
Brand: Beta LifeScience
SKU: BLC-10709P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, Explore high-quality enzymes for research and supplementation, Featured enzyme molecules, High-quality recombinant proteins, Protease

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Renin Receptor (ATP6AP2) Protein (His) is produced by our Yeast expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	O75787
Target Symbol	ATP6AP2
Synonyms	APT6M8 9; APT6M8-9; ATP6AP2; ATP6IP2; ATP6M8-9; ATPase H(+)-transporting lysosomal accessory protein 2; ATPase H(+)-transporting lysosomal-interacting protein 2; ATPase H+ transporting lysosomal accessory protein 2; ATPase H+ transporting lysosomal interacting protein 2; ATPase H+ transporting lysosomal vacuolar proton pump membrane sector associated protein M8 9; ATPase membrane sector associated protein M8 9; ATPase; H+ transporting; lysosomal (vacuolar proton pump) membrane sector associated protein M8 9; CAPER; ELDF10; Embryonic liver differentiation factor 10; ER localized type I transmembrane adaptor; ER-localized type I transmembrane adaptor; HT028; M8 9; M8-9; MGC99577; MRXE; MSTP009; N14F; Renin receptor; Renin/prorenin receptor; RENR_HUMAN; V ATPase M8 9 subunit; V ATPase M8.9 subunit; V-ATPase M8.9 subunit; Vacuolar ATP synthase membrane sector associated protein M8 9; Vacuolar ATP synthase membrane sector-associated protein M8-9; vacuolar proton ATP synthase membrane sector associated protein M8 9; XMRE
Species	Homo sapiens (Human)
Expression System	Yeast
Tag	N-10His
Target Protein Sequence	NEFSILKSPGSVVFRNGNWPIPGERIPDVAALSMGFSVKEDLSWPGLAVGNLFHRPRATVMVMVKGVNKLALPPGSVISYPLENAVPFSLDSVANSIHSLFSEETPVVLQLAPSEERVYMVGKANSVFEDLSVTLRQLRNRLFQENSVLSSLPLNSLSRNNEVDLLFLSELQVLHDISSLLSRHKHLAKDHSPDLYSLELAGLDEIGKRYGEDSEQFRDASKILVDALQKFADDMYSLYGGNAVVELVTVKSFDTSLIRKTRTILEAKQAKNPASPYNLAYKYNFEYSVVFNMVLWIMIALALAVIITSYNIWNMDPGYDSIIYRMTNQKIRMD
Expression Range	17-350
Protein Length	Full Length of Mature Protein
Mol. Weight	40.0kDa
Research Area	Signal Transduction
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Multifunctional protein which functions as a renin, prorenin cellular receptor and is involved in the assembly of the lysosomal proton-transporting V-type ATPase (v-ATPase) and the acidification of the endo-lysosomal system. May mediate renin-dependent cellular responses by activating ERK1 and ERK2. By increasing the catalytic efficiency of renin in AGT/angiotensinogen conversion to angiotensin I, may also play a role in the renin-angiotensin system (RAS). Through its function in V-type ATPase (v-ATPase) assembly and acidification of the lysosome it regulates protein degradation and may control different signaling pathways important for proper brain development, synapse morphology and synaptic transmission.
Subcellular Location	Endoplasmic reticulum membrane; Single-pass type I membrane protein. Lysosome membrane. Cytoplasmic vesicle, autophagosome membrane. Cell projection, dendritic spine membrane. Cell projection, axon. Endosome membrane.
Database References	HGNC: 18305 OMIM: 300423 KEGG: hsa:10159 STRING: 9606.ENSP00000367697 UniGene: PMID: 27654965 Soluble (pro)renin receptor is dysregulated in pregnancies affected by diabetes mellitus, but not in preeclampsia. PMID: 29050747 maternal serum concentrations may reflect acceleration of tissue renin-angiotensin system in the placenta and blood pressure severity PMID: 28864001 The aim of this review, is to highlight new insights into the cellular and molecular mechanisms by which PRR may regulate UB branching, terminal differentiation and function of UB-derived collecting ducts, nephron progenitor maintenance, progression of nephrogenesis and normal structural kidney development and function--{REVIEW} PMID: 27160552 Overexpression of PRR is associated with pancreatic ductal adenocarcinoma. PMID: 28874965 the missense mutations in ATP6AP2 lead to impaired V-ATPase assembly and subsequent defects in glycosylation and autophagy. PMID: 29127204 High ATP6AP2 expression is associated with Renal Damage. PMID: 27228084 serum s(P)RR could be used as a marker for atherosclerotic conditions in hemodialysis patients PMID: 27367528 (P)RR may contribute to the homeostatic control of erythropoiesis. PMID: 28090037 Placental (P)RR can be involved in blood pressure regulation via the tissue RAS. On the other hand, plasma s(P)RR may be involved in the pathogenesis of decreased renal function in preeclampsia. PMID: 26684753 the present results suggest that ATP6AP2 rs5918007T might be susceptible factors for Essential Hypertension in Chinese Han population. PMID: 26625836 A mutation in the splice site following exon 2 may affect splicing due to its close proximity to the exon-intron boundary. It was associated with epilepsy, Parkinsonism and intellectual disability in 2 brothers. PMID: 26467484 Study identifies a renin-angiotensin system-independent function for the (P)RR in the regulation of LDL metabolism by controlling the levels of SORT1 and LDL receptor. PMID: 26582775 markedly expressed in adrenocortical zona glomerulosa and aldosterone-producing adenoma PMID: 25668351 Prorenin receptor promotes atrial structural and electric remodeling and plays an important role in the pathological development of atrial fibrillation. PMID: 25697868 Demonstrate that there are strong interactions between prorenin, ATP6AP2, and TGFB1 and that this system has a greater capacity in female amnion to stimulate profibrotic pathways, thus maintaining the integrity of the fetal membranes. PMID: 25491485 a novel GLP1R Interacting Protein ATP6ap2 PMID: 26272612 Crosstalk between (Pro)renin receptor and COX-2 in the renal medulla during angiotensin II-induced hypertension PMID: 25681793 This is the first demonstration that (P)RR may be profoundly involved in ductal tumorigenesis in the pancreas. PMID: 25747895 The binding of prorenin to PRR can promote proliferation and upregulate the anti-apoptotic protein Bcl-2 and downregulate the pro-apoptotic protein Bax independently PMID: 24591529 MicroRNA-152 represses VEGF and TGFbeta1 expressions through post-transcriptional inhibition of prorenin receptor in human retinal endothelial cells. PMID: 25802486 Data indicate that (pro)renin receptor ATP6PA2 interacts with the E1 beta subunit of pyruvate dehydrogenase and controlling its protein stability PMID: 25720494 expressed by lymphocytes and macrophages PMID: 25503726 activation of (P)RR and AT1R is associated with the pathogenesis of conjunctival EMZL by stimulating the production of FGF2 and MMPs. PMID: 25503453 The aim of this study was to analyse the contribution of constitutive (P)RR activity to its cellular effects and the relevance of prorenin glycosylation on its ligand activity. PMID: 24424509 The extracellular domain (ECD) and transmembrane domain (TM) of ATP6AP2 were indispensable for the biogenesis of active V-ATPase. PMID: 24223829 The expression of (P)RR in erythroid cells, raising the possibility that (P)RR may have a role in erythropoiesis and the pathophysiology of certain types of anemia. PMID: 22884881 Plasma levels of prorenin receptor are increased in heart failure patients with renal dysfunction. PMID: 23673200 This study demonstrates that the the extracellular domain of ATP6AP2 participates in dimerization. PMID: 24472541 Pro)renin receptor and insulin resistance: possible roles of angiotensin II-dependent and -independent pathways. [review] PMID: 22684035 Plasma sPRR concentrations are dependent on ethnicity and independent of renin, prorenin, and aldosterone concentrations in healthy subjects and in patients with contrasted degrees of renin-angiotensin system activity. PMID: 24218434 Studies indicated that various polymorphisms in the (P)RR/ATP6ap2 gene associated with increased cardiovascular risks. PMID: 24400720 Results show that reduction of the full-size ATP6AP2 transcript in XPDS cells and decreased level of ATP6AP2 protein in XPDS brain may compromise V-ATPase function and may ultimately be responsible for the pathology. PMID: 23595882 High s(P)RR concentration is associated with a lower SGA birth likelihood. PMID: 23555874 Report the presence of prorenin receptor in human substantia nigra. PMID: 22407459 The(pro)renin receptor mediates EGF receptor transactivation in both Ang II-dependent and -independent pathways. PMID: 23277024 These in vitro data indicate that prorenin acidified in vivo possibly modulate renin angiotensin system in (pro)renin receptor-dependent and/or -independent manners which could ultimately lead to the pathogenesis of diseases. PMID: 23111329 Our data using human samples provide the first evidence that prorenin receptor is associated with angiogenic activity in proliferative diabetic retinopathy. PMID: 22930161 Data indicate that high circulating levels of s(P)RR at early pregnancy predicted a subsequent elevation in blood pressure, and high concentrations at delivery were significantly associated with preeclampsia. PMID: 23045457 Prorenin is a chemotactic factor for human aortic smooth muscle cells expressing prorenin receptor. PMID: 22721990 (P)RR gene activity may be controlled by intracellular AngII. PMID: 21997900 Angiotensin generation depending on prorenin-(P)RR interaction may occur in transgenic rodents overexpressing prorenin several 100-fold. PMID: 22025376 Decidual prorenin may be involved in the labour-associated increase in amnion PGHS-2 abundance via the (pro)renin receptor. PMID: 20702505 that (P)RR influences blood pressure regulation in Caucasian men, potentially through altered aldosterone release PMID: 21346687 Prorenin receptor is mainly localized in the subcellular organelles, such as the endoplasmic reticulum and Golgi apparatus, and the prorenin receptor is cleaved by ADAM19 in the Golgi, resulting in two fragments. PMID: 21270819 The polymorphism of the (P)RR gene +1513A>G is associated with lacunar infarction and left ventricular hypertrophy in Japanese women. These results suggest that (P)RR has a role in organ damage in humans PMID: 21228785 Report expression (pro)renin receptors and angiotensin converting enzyme 2/angiotensin-(1-7)/Mas receptor axis in human aortic valve stenosis. PMID: 21316680 the crystal structure of the PRR-IC domain as maltose-binding protein (MBP) fusion proteins at 2.0A (maltose-free) and 2.15A (maltose-bound) was reported. PMID: 21420935 Demonstrate that the (pro)renin receptor (PRR) is expressed in retinal pigment epithelium and may have a role in hypertensive exacerbation of dry age-related macular degeneration. PMID: 19580809 Expression of (pro)renin receptor in human kidneys with end-stage kidney disease due to diabetic nephropathy PMID: 20385187

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.