Recombinant Human Renin Receptor (ATP6AP2) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-03158P

Greater than 90% as determined by SDS-PAGE.
Recombinant Human Renin Receptor (ATP6AP2) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-03158P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Renin Receptor (ATP6AP2) Protein (His) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | O75787 |
Target Symbol | ATP6AP2 |
Synonyms | APT6M8 9; APT6M8-9; ATP6AP2; ATP6IP2; ATP6M8-9; ATPase H(+)-transporting lysosomal accessory protein 2; ATPase H(+)-transporting lysosomal-interacting protein 2; ATPase H+ transporting lysosomal accessory protein 2; ATPase H+ transporting lysosomal interacting protein 2; ATPase H+ transporting lysosomal vacuolar proton pump membrane sector associated protein M8 9; ATPase membrane sector associated protein M8 9; ATPase; H+ transporting; lysosomal (vacuolar proton pump) membrane sector associated protein M8 9; CAPER; ELDF10; Embryonic liver differentiation factor 10; ER localized type I transmembrane adaptor; ER-localized type I transmembrane adaptor; HT028; M8 9; M8-9; MGC99577; MRXE; MSTP009; N14F; Renin receptor; Renin/prorenin receptor; RENR_HUMAN; V ATPase M8 9 subunit; V ATPase M8.9 subunit; V-ATPase M8.9 subunit; Vacuolar ATP synthase membrane sector associated protein M8 9; Vacuolar ATP synthase membrane sector-associated protein M8-9; vacuolar proton ATP synthase membrane sector associated protein M8 9; XMRE |
Species | Homo sapiens (Human) |
Expression System | E.coli |
Tag | N-6His |
Target Protein Sequence | NEFSILKSPGSVVFRNGNWPIPGERIPDVAALSMGFSVKEDLSWPGLAVGNLFHRPRATVMVMVKGVNKLALPPGSVISYPLENAVPFSLDSVANSIHSLFSEETPVVLQLAPSEERVYMVGKANSVFEDLSVTLRQLRNRLFQENSVLSSLPLNSLSRNNEVDLLFLSELQVLHDISSLLSRHKHLAKDHSPDLYSLELAGLDEIGKRYGEDSEQFRDASKILVDALQKFADDMYSLYGGNAVVELVTVKSFDTSLIRKTRTILEAKQAKNPASPYNLAYKYNFEYSVVFNMVLWIMIALALAVIITSYNIWNMDPGYDSIIYRMTNQKIRMD |
Expression Range | 17-350aa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 41.5kDa |
Research Area | Signal Transduction |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Multifunctional protein which functions as a renin, prorenin cellular receptor and is involved in the assembly of the lysosomal proton-transporting V-type ATPase (v-ATPase) and the acidification of the endo-lysosomal system. May mediate renin-dependent cellular responses by activating ERK1 and ERK2. By increasing the catalytic efficiency of renin in AGT/angiotensinogen conversion to angiotensin I, may also play a role in the renin-angiotensin system (RAS). Through its function in V-type ATPase (v-ATPase) assembly and acidification of the lysosome it regulates protein degradation and may control different signaling pathways important for proper brain development, synapse morphology and synaptic transmission. |
Subcellular Location | Endoplasmic reticulum membrane; Single-pass type I membrane protein. Lysosome membrane. Cytoplasmic vesicle, autophagosome membrane. Cell projection, dendritic spine membrane. Cell projection, axon. Endosome membrane. |
Database References | HGNC: 18305 OMIM: 300423 KEGG: hsa:10159 STRING: 9606.ENSP00000367697 UniGene: PMID: 27654965 |