Recombinant Human Regulator Of G-Protein Signaling 5 (RGS5) Protein (GST)

Name: Recombinant Human Regulator Of G-Protein Signaling 5 (RGS5) Protein (GST)
Brand: Beta LifeScience
SKU: BLC-09162P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Product Overview

Description	Recombinant Human Regulator Of G-Protein Signaling 5 (RGS5) Protein (GST) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	O15539
Target Symbol	RGS5
Synonyms	MST092; MST106; MST129; MSTP032; MSTP092; MSTP106; MSTP129; Regulator of G Protein Signalling 5; Regulator of G-protein signaling 5; RGS 5; RGS5; RGS5_HUMAN
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-GST
Target Protein Sequence	MCKGLAALPHSCLERAKEIKIKLGILLQKPDSVGDLVIPYNEKPEKPAKTQKTSLDEALQWRDSLDKLLQNNYGLASFKSFLKSEFSEENLEFWIACEDYKKIKSPAKMAEKAKQIYEEFIQTEAPKEVNIDHFTKDITMKNLVEPSLSSFDMAQKRIHALMEKDSLPRFVRSEFYQELIK
Expression Range	1-181aa
Protein Length	Full Length
Mol. Weight	47.9kDa
Research Area	Signal Transduction
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form. Binds to G(i)-alpha and G(o)-alpha, but not to G(s)-alpha.
Subcellular Location	[Isoform 1]: Cytoplasm. Membrane.; [Isoform 2]: Cytoplasm.
Database References	HGNC: 10001 OMIM: 603276 KEGG: hsa:8490 STRING: 9606.ENSP00000319308 UniGene: Hs.24950

Gene Functions References

The chimeric RGS8 domains containing the first or the second exon part of RGS5 showed strong inhibitory effects similar to that of wild type RGS8, but the chimeric domain with the third exon part of RGS5 lost its activity PMID: 26754208
Rgs5 prevents vagal-related bradycardia and atrial tachycardia by negatively regulating the IKA Ach current. PMID: 26961238
The rs16849802 of RGS5 and haplotype GAA independently increased the risk of essential hypertension in Mongolian patients, and may be used as a risk factor for the prediction of high blood pressure. PMID: 26782409
Downregulation of RGS5 is an important prerequisite for smooth muscle cell proliferation in vascular injury model. PMID: 26663397
The pericyte marker RGS5 may be of future clinical utility for the evaluation of pericytic differentiation in soft tissue tumors. PMID: 26558691
RGS5 enhanced the cytotoxic effect of radiation in the human lung cancer cells. Our results indicated that RGS5 may be a potential target for cancer therapy. PMID: 25891540
Our work identifies a new genetic variant in RGS5 demonstrating additive effect with PDE4D, both implicated in modulation of asthma treatment. PMID: 23193110
ectopic expression of R4 subfamily members RGS2, RGS3, RGS4, and RGS5 reduced activated PAR1 wild-type signaling, whereas signaling by the PAR1 AKKAA mutant was minimally affected. PMID: 24297163
RGS1 is largely upregulated, whereas RGS2 is downregulated in the majority of solid tumors, whereas RGS5 transcripts are greatly increased in eight subtypes of lymphoma with no reports of downregulation in hematological malignancies PMID: 23464602
Over-expression of regulator of G protein signaling 5 promotes tumor metastasis by inducing epithelial-mesenchymal transition in hepatocellular carcinoma cells. PMID: 23868206
demonstrate RGS5 in the blood vessels of other cancer models endowed with a proangiogenic environment, such as human melanoma and renal carcinoma xenografts PMID: 22130514
Low expression of RGS5 was strongly associated with cancer vasculature invasion and lymph node metastasis in non-small cell lung cancer. PMID: 21780128
examined polymorphisms in three genes (ATP1B1, RGS5 and SELE) in relation to hypertension and blood pressure in a cohort of African-Americans PMID: 21881522
regulator of G-protein signaling 5 can act as a physiological regulator of calcium sensing by calcium sensing receptor in the parathyroid gland PMID: 21393447
Repetitive beta(2)-agonist use may not only lead to reduced bronchoprotection but also to sensitization of excitation-contraction signaling pathways as a result of reduced RGS5 expression PMID: 21278382
RGS5 expression level in gastric carcinoma is associated with the differentiation and microvascular density of the tumor, and may be used as an important parameter for determining the prognosis of gastric carcinoma patients. PMID: 21105200
used transgenic mice show that the cardiac constitutive expression of human Rgs5 protects against cardiac hypertrophy and fibrosis by blocking MEK-ERK1/2 signaling, whereas Rgs5-/- mice displayed the opposite phenotype. PMID: 20643937
Multiple SNPs in combination in RGS5 may confer risk for hypertension. Our results also lend support for the effect of RGS5 SNPs on lipid metabolism PMID: 19863299
There is a contribution of RGS5 to schizophrenia susceptibility. PMID: 14755443
Elevated levels of RGS-5 in pericytes are also observed during wound healing and ovulation indicating a strong correlation between RGS-5 expression and active vessel remodeling. PMID: 15459006
The loss of RGS5 in the fibrous cap is of particular interest because of its role in vessel development and physiology and loss in fibrous cap of atherosclerosis PMID: 16293795
x-ray crystallography of the complex of RGS5 and Galphai(3) proteins with GDP/Mg(2+)/AlF(4)(-) at 3.0 A resolution PMID: 17100651
examined function, receptor specificity, and expression of R4 subfamily RGS proteins, RGS2, -3, -4, -5, and -8 via missense mutations introduced PMID: 17220356
RGS5 dimerization was confirmed by the analysis of a GFP tagged RGS5 fusion in yeast and with two-hybrid assays PMID: 17762159
Rgs5 and Notch3 are expressed in pericytes of developing and injured teeth and have roles along with vascular-derived stem cells during pulp healing PMID: 17939118
RGS5 genotypes predicted severity of baseline symptoms in schizophrenia. These data suggest a possible role for multiple RGS proteins in schizophrenia. PMID: 18262772
RGS5 is a novel HIF-1-dependent, hypoxia-induced gene that is involved in the induction of endothelial apoptosis. PMID: 19564336

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.