Recombinant Human Regulator Of G-Protein Signaling 17 (RGS17) Protein (GST), Active

Name: Recombinant Human Regulator Of G-Protein Signaling 17 (RGS17) Protein (GST), Active
Brand: Beta LifeScience
SKU: BLC-05591P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Activity Measured by its binding ability in a functional ELISA. Immobilized AQP1 at 2 μg/ml can bind human RGS17, the EC 50 of human RGS17 protein is 31.63-34.44 μg/ml.

Collections: High-quality recombinant proteins, Other recombinant proteins, Recombinant proteins fall special offers - active proteins, Recombinant proteins fall special offers - full-length proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Regulator Of G-Protein Signaling 17 (RGS17) Protein (GST), Active is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 85% as determined by SDS-PAGE.
Activity	Measured by its binding ability in a functional ELISA. Immobilized AQP1 at 2 μg/ml can bind human RGS17, the EC50 of human RGS17 protein is 31.63-34.44 μg/ml.
Uniprotkb	Q9UGC6
Target Symbol	RGS17
Synonyms	hRGS17; Regulator of G protein signalling 17; Regulator of G protein signalling Z2; Regulator of G-protein signaling 17; RGS-17; RGS17; RGS17_HUMAN; RGSZ2
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-GST
Target Protein Sequence	MRKRQQSQNEGTPAVSQAPGNQRPNNTCCFCWCCCCSCSCLTVRNEERGENAGRPTHTTKMESIQVLEECQNPTAEEVLSWSQNFDKMMKAPAGRNLFREFLRTEYSEENLLFWLACEDLKKEQNKKVIEEKARMIYEDYISILSPKEVSLDSRVREVINRNLLDPNPHMYEDAQLQIYTLMHRDSFPRFLNSQIYKSFVESTAGSSSES
Expression Range	1-210aa
Protein Length	Full Length
Mol. Weight	51.4 kDa
Research Area	Signal Transduction
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Regulates G protein-coupled receptor signaling cascades, including signaling via muscarinic acetylcholine receptor CHRM2 and dopamine receptor DRD2. Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits, thereby driving them into their inactive GDP-bound form. Binds selectively to GNAZ and GNAI2 subunits, accelerates their GTPase activity and regulates their signaling activities. Negatively regulates mu-opioid receptor-mediated activation of the G-proteins.
Subcellular Location	Membrane. Cell junction, synapse, synaptosome. Nucleus. Cytoplasm.
Database References	HGNC: 14088 OMIM: 607191 KEGG: hsa:26575 STRING: 9606.ENSP00000206262 UniGene: PMID: 28337960 Results showed that RGS17 overexpression promoted hepatocarcinoma (HCC) cell proliferation, migration, and invasion, and reversed the miR-199 mediated inhibition of proliferation, migration, and invasion. PMID: 29559347 Taken together, the results suggested that expression of miR-203 inhibited non-small-cell lung cancer tumor growth and metastasis by targeting RGS17 PMID: 28921827 Variation in RGS17 was associated with risk for substance dependence diagnoses in both African American and European American populations. PMID: 22591552 Two single nucleotide polymorphisms in the regulator of G-protein signaling 17 gene are associated with smoking initiation. PMID: 22006218 RGS17 is differentially expressed in hepatocellular carcinoma cells and plays a central role in regulating transformed hepatocyte tumorgenicity. PMID: 21620966 Results establish RGS10 and RGS17 as novel regulators of cell survival and chemoresistance in ovarian cancer cells and suggest that their reduced expression may be diagnostic of chemoresistance. PMID: 21044322 Taken together, these data have provided the first evidence of miRNA regulation of RGS17 expression in lung cancer. PMID: 20420807 RGS17 is a new RZ member that preferentially inhibits receptor signaling via G(i/o), G(z), and G(q) over G(s) to enhance cAMP-dependent signaling and inhibit calcium signaling PMID: 15096504 RGS17, an overexpressed gene in human lung and prostate cancer, induces tumor cell proliferation through the cyclic AMP-PKA-CREB pathway. PMID: 19244110 RGS17 is a major candidate for the familial lung cancer susceptibility locus on chromosome 6q23-25. PMID: 19351763

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.