Recombinant Human Regenerating Islet-Derived Protein 3-Alpha (REG3A) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-04484P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Regenerating Islet-Derived Protein 3-Alpha (REG3A) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-04484P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Regenerating Islet-Derived Protein 3-Alpha (REG3A) Protein (GST) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | Q06141 |
| Target Symbol | REG3A |
| Synonyms | FLJ18565; Hepatocarcinoma intestine pancreas; Hepatointestinal pancreatic protein; HIP; HIP/PAP; Human proislet peptide; INGAP; Pancreatic beta cell growth factor; Pancreatitis associated protein 1; Pancreatitis associated protein; Pancreatitis-associated protein 1; PAP; PAP H; PAP homologous protein; PAP1; PBCGF; Proliferation inducing protein 34; Proliferation inducing protein 42; Reg III alpha; REG III; Reg III-alpha; REG-3-alpha; REG3; Reg3a; REG3A_HUMAN; Regenerating islet derived 3 alpha; Regenerating islet derived protein 3 alpha precursor; Regenerating islet-derived protein 3-alpha 15 kDa form; Regenerating islet-derived protein III-alpha |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-GST |
| Target Protein Sequence | EEPQRELPSARIRCPKGSKAYGSHCYALFLSPKSWTDADLACQKRPSGNLVSVLSGAEGSFVSSLVKSIGNSYSYVWIGLHDPTQGTEPNGEGWEWSSSDVMNYFAWERNPSTISSPGHCASLSRSTAFLRWKDYNCNVRLPYVCKFTD |
| Expression Range | 27-175aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 43.6kDa |
| Research Area | Immunology |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Bactericidal C-type lectin which acts exclusively against Gram-positive bacteria and mediates bacterial killing by binding to surface-exposed carbohydrate moieties of peptidoglycan. Regulates keratinocyte proliferation and differentiation after skin injury via activation of EXTL3-PI3K-AKT signaling pathway. |
| Subcellular Location | Secreted. Note=Found in the apical region of pancreatic acinar cells. |
| Database References | HGNC: 8601 OMIM: 167805 KEGG: hsa:5068 STRING: 9606.ENSP00000304311 UniGene: PMID: 27830702 |
