Recombinant Human Recoverin (RCVRN) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-02854P

Greater than 90% as determined by SDS-PAGE.
Recombinant Human Recoverin (RCVRN) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-02854P
Collections: High-quality recombinant proteins, Other recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Recoverin (RCVRN) Protein (His&Myc) is produced by our Mammalian cell expression system. This is a full length protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | P35243 |
Target Symbol | RCVRN |
Synonyms | 23 kDa photoreceptor cell-specific protein; Cancer associated retinopathy protein; Cancer-associated retinopathy protein; CAR; CAR protein; p26; Protein CAR; RCV1; RCVRN; RECO_HUMAN; Recoverin; S-modulin |
Species | Homo sapiens (Human) |
Expression System | Mammalian cell |
Tag | N-10His&C-Myc |
Target Protein Sequence | GNSKSGALSKEILEELQLNTKFSEEELCSWYQSFLKDCPTGRITQQQFQSIYAKFFPDTDPKAYAQHVFRSFDSNLDGTLDFKEYVIALHMTTAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVMAIFKMITPEDVKLLPDDENTPEKRAEKIWKYFGKNDDDKLTEKEFIEGTLANKEILRLIQFEPQKVKEKMKNA |
Expression Range | 2-200aa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 27.0 kDa |
Research Area | Neuroscience |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Acts as a calcium sensor and regulates phototransduction of cone and rod photoreceptor cells. Modulates light sensitivity of cone photoreceptor in dark and dim conditions. In response to high Ca(2+) levels induced by low light levels, prolongs RHO/rhodopsin activation in rod photoreceptor cells by binding to and inhibiting GRK1-mediated phosphorylation of RHO/rhodopsin. Plays a role in scotopic vision/enhances vision in dim light by enhancing signal transfer between rod photoreceptors and rod bipolar cells. Improves rod photoreceptor sensitivity in dim light and mediates response of rod photoreceptors to facilitate detection of change and motion in bright light. |
Subcellular Location | Photoreceptor inner segment. Cell projection, cilium, photoreceptor outer segment. Photoreceptor outer segment membrane; Lipid-anchor; Cytoplasmic side. Perikaryon. |
Protein Families | Recoverin family |
Database References | |
Tissue Specificity | Retina and pineal gland. |
Gene Functions References
- High RCVRN expression is associated with renal tumors. PMID: 26813565
- Crystal Structure of Recoverin with Calcium Ions Bound to Both Functional EF Hands. PMID: 26584024
- C39D substitution reduces alpha-helical content, decreases thermal stability and suppresses membrane association. PMID: 21344177
- Aberrant hypomethylation of the recoverin gene region, overlapping the promoter up-stream of the first exon and the first exon itself, is involved in the aberrant expression of recoverin in tumor cells. PMID: 20812967
- recoverin has a pathological role in cancer-associated retinopathy PMID: 12596918
- There are cis-acting elements in the 5' non-coding region of the recoverin gene that are involved in the activation and suppression of gene expression. PMID: 12789533
- Human recoverin is expressed in SCLC cells cultured from an anti-recoverin antibody-negative patient with CAR. KK0206 might be important for further research on SCLC related retinopathy. PMID: 17374419
- A GRK1 region close to its C-terminus also seemed to be the binding site for S-modulin/recoverin. PMID: 18266817