Recombinant Human Recoverin (RCVRN) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-03344P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Recoverin (RCVRN) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-03344P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Recoverin (RCVRN) Protein (His) is produced by our Yeast expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | P35243 |
| Target Symbol | RCVRN |
| Synonyms | 23 kDa photoreceptor cell-specific protein; Cancer associated retinopathy protein; Cancer-associated retinopathy protein; CAR; CAR protein; p26; Protein CAR; RCV1; RCVRN; RECO_HUMAN; Recoverin; S-modulin |
| Species | Homo sapiens (Human) |
| Expression System | Yeast |
| Tag | N-6His |
| Target Protein Sequence | GNSKSGALSKEILEELQLNTKFSEEELCSWYQSFLKDCPTGRITQQQFQSIYAKFFPDTDPKAYAQHVFRSFDSNLDGTLDFKEYVIALHMTTAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVMAIFKMITPEDVKLLPDDENTPEKRAEKIWKYFGKNDDDKLTEKEFIEGTLANKEILRLIQFEPQKVKEKMKNA |
| Expression Range | 2-200aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 25.0kDa |
| Research Area | Neuroscience |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Acts as a calcium sensor and regulates phototransduction of cone and rod photoreceptor cells. Modulates light sensitivity of cone photoreceptor in dark and dim conditions. In response to high Ca(2+) levels induced by low light levels, prolongs RHO/rhodopsin activation in rod photoreceptor cells by binding to and inhibiting GRK1-mediated phosphorylation of RHO/rhodopsin. Plays a role in scotopic vision/enhances vision in dim light by enhancing signal transfer between rod photoreceptors and rod bipolar cells. Improves rod photoreceptor sensitivity in dim light and mediates response of rod photoreceptors to facilitate detection of change and motion in bright light. |
| Subcellular Location | Photoreceptor inner segment. Cell projection, cilium, photoreceptor outer segment. Photoreceptor outer segment membrane; Lipid-anchor; Cytoplasmic side. Perikaryon. |
| Protein Families | Recoverin family |
| Database References | HGNC: 9937 OMIM: 179618 KEGG: hsa:5957 STRING: 9606.ENSP00000226193 UniGene: PMID: 26813565 |
