Recombinant Human Receptor Tyrosine-Protein Kinase Erbb-3 (ERBB3) Protein (hFc), Active

Name: Recombinant Human Receptor Tyrosine-Protein Kinase Erbb-3 (ERBB3) Protein (hFc), Active
Brand: Beta LifeScience
SKU: BLC-05829P
Availability: InStock

Greater than 95% as determined by SDS-PAGE.

Activity Measured by its binding ability in a functional ELISA. Immobilized NRG1) at 2 μg/ml can bind human ERBB3, the EC 50 is 12.32-15.74 ng/ml. Biological Activity Assay

Collections: All products, Antibody / cell therapy targets, Antibody therapeutic / adc target proteins, High-quality recombinant proteins, Other recombinant proteins, Recombinant cell therapy targets for car-t research

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Receptor Tyrosine-Protein Kinase Erbb-3 (ERBB3) Protein (hFc), Active is produced by our Mammalian cell expression system. This is a protein fragment.
Purity	Greater than 95% as determined by SDS-PAGE.
Endotoxin	Less than 1.0 EU/ug as determined by LAL method.
Activity	Measured by its binding ability in a functional ELISA. Immobilized NRG1) at 2 μg/ml can bind human ERBB3, the EC 50 is 12.32-15.74 ng/ml.
Uniprotkb	P21860
Target Symbol	ERBB3
Synonyms	(Proto-oncogene-like protein c-ErbB-3)(Tyrosine kinase-type cell surface receptor HER3)(HER3)
Species	Homo sapiens (Human)
Expression System	Mammalian cell
Tag	C-hFc
Target Protein Sequence	SEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVMGNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSTLPLPNLRVVRGTQVYDGKFAIFVMLNYNTNSSHALRQLRLTQLTEILSGGVYIEKNDKLCHMDTIDWRDIVRDRDAEIVVKDNGRSCPPCHEVCKGRCWGPGSEDCQTLTKTICAPQCNGHCFGPNPNQCCHDECAGGCSGPQDTDCFACRHFNDSGACVPRCPQPLVYNKLTFQLEPNPHTKYQYGGVCVASCPHNFVVDQTSCVRACPPDKMEVDKNGLKMCEPCGGLCPKACEGTGSGSRFQTVDSSNIDGFVNCTKILGNLDFLITGLNGDPWHKIPALDPEKLNVFRTVREITGYLNIQSWPPHMHNFSVFSNLTTIGGRSLYNRGFSLLIMKNLNVTSLGFRSLKEISAGRIYISANRQLCYHHSLNWTKVLRGPTEERLDIKHNRPRRDCVAEGKVCDPLCSSGGCWGPGPGQCLSCRNYSRGGVCVTHCNFLNGEPREFAHEAECFSCHPECQPMEGTATCNGSGSDTCAQCAHFRDGPHCVSSCPHGVLGAKGPIYKYPDVQNECRPCHENCTQGCKGPELQDCLGQTLVLIGKTHLT
Expression Range	20-643aa
Protein Length	Partial
Mol. Weight	96.4 kDa
Form	Lyophilized powder
Buffer	Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Tyrosine-protein kinase that plays an essential role as cell surface receptor for neuregulins. Binds to neuregulin-1 (NRG1) and is activated by it; ligand-binding increases phosphorylation on tyrosine residues and promotes its association with the p85 subunit of phosphatidylinositol 3-kinase. May also be activated by CSPG5. Involved in the regulation of myeloid cell differentiation.
Subcellular Location	[Isoform 1]: Cell membrane; Single-pass type I membrane protein.; [Isoform 2]: Secreted.
Protein Families	Protein kinase superfamily, Tyr protein kinase family, EGF receptor subfamily
Database References	HGNC: 3431 OMIM: 190151 KEGG: hsa:2065 STRING: 9606.ENSP00000267101 UniGene: PMID: 29413684 identified P2RX2, KCNQ5, ERBB3 and SOCS3 to be associated with the progression of age-related hearing impairment PMID: 29325454 Results demonstrate that 4-PBA promotes gastric cancer cells migration through upregulation of HER3/HER4 subsequent to increased levels of acetyl-histone and activation of ERK signaling. PMID: 28851073 miR152 was found to be involved in the proliferation and metastasis of ovarian cancer cells through repression of ERBB3 expression. PMID: 29286064 This phase Ib study was designed to determine the MTD, safety, preliminary efficacy, and pharmacokinetics of the HER3 (ErbB3) mAb SAR256212 in combination with the oral PI3K inhibitor SAR245408 for patients with metastatic or locally advanced solid tumors. PMID: 28031425 To determine additional resistance mechanisms to cetuximab treatment besides HER3 signaling. PMID: 28910149 Study shows ErbB3 expression was markedly decreased in suicide completers compared to controls. PMID: 28675388 EGFR expression is increased in oesophageal and gastric adenocarcinomas after neoadjuvant therapy and was significantly associated with a prolonged overall survival in univariable analysis. PMID: 29138285 Using time-resolved-fluorescence energy transfer (TR-FRET), we demonstrated that in the presence of recombinant NRG1, binding of 9F7-F11 to HER3 is increased, whereas that of ligand-competing anti-HER3 antibodies (H4B-121, U3-1287, Ab#6, Mab205.10.2, and MOR09825) is decreased. PMID: 28507002 This study uncovers a direct relationship between HPV infection and HER3 in head and neck squamous cell carcinomas and provides a rationale for the clinical evaluation of targeted HER3 therapy for the treatment of HPV(+) patients. PMID: 27986750 Cetuximab treatment induced HER3 activation and HER2/HER3 dimerization in head and neck squamous cell carcinoma cell lines. Cetuximab induces HER3 expression and activation in HNSCC cell lines. Upregulation of HER3 by cetuximab is one mechanism underlying resistance to EGFR inhibition in HNSCC. PMID: 27358485 High HER3 expression is associated with breast cancer. PMID: 27582551 hematopoietic expression of ERBB3 appears to be highest in bone marrow common myeloid and megakaryocyte-erythrocyte progenitors. Identified ERBB3 as a candidate gene for predisposition to erythroid MDS/AML PMID: 27416908 High LINC00052 levels predict activation of HER3-mediated signaling, promoting breast cancer growth. PMID: 28036286 we show that ErbB3 interacts with the ESCRT-0 subunit Hrs both in the presence and absence of heregulin. This indicates an ESCRT-mediated sorting of ErbB3 to late endosomes and lysosomes, and in line with this we show that impaired ESCRT function leads to an endosomal accumulation of ErbB3. PMID: 28867611 our findings provide support for an autocrine signaling loop engaged by oncogenic K-Ras involving ErbB3 that contributes to the dedifferentiation of the intestinal epithelium during tumor initiation and progression. PMID: 27447549 Results indicate the feasibility by using a pharmacophore of the small molecular compound VS1 for designing and optimization of proto-oncogene protein erbB-3 (ERBB3) inhibitors. PMID: 27188722 The A/A genotype of the ERBB3 rs2292239 SNP is associated with risk for T1DM in a white Brazilian population. PMID: 29109006 Results shows that HER3 mRNA is upregulated in hepatocellular carcinoma associated to chronic HBV infection. PMID: 27514687 Data show that afatinib resistant clones were selectively killed by knock down of ERBB3 + c-MET + c-KIT, but not by the individual or doublet knock down combinations, and the combination of afatinib with the SRC family inhibitor dasatinib killed afatinib resistant H1975 cells in a greater than additive fashion. PMID: 26934000 results suggest that the combination of a histone deacetylase inhibitor (HDACi) plus an anti-ErbB3 MoAb represents a viable strategy that warrants further evaluation for the treatment of non-small cell lung cancer (NSCLC) patients. PMID: 26862736 observations suggest that Rtn4A counteracts the Nrdp1-mediated degradation of ErbB3 by sequestering the ubiquitin ligase into ER tubules. PMID: 27353365 Engineered multivalency enhanced affibody-mediated HER3 downregulation in multiple cancer cell types. PMID: 28248115 Pretreatment with the soluble ErbB3 N418Q mutant suppressed heregulin beta1-induced HIF-1alpha activation in MCF7 cells. PMID: 25451255 review and meta-analysis of essential role in clinicopathology and prognosis of gastric cancer PMID: 27536774 HER3 is frequently overexpressed in high-grade dysplastic lesions of the gastroesophageal junction and may be a marker of invasive progression PMID: 27559738 the mechanistic regulation and linkage of the ROR1-HER3 and Hippo-YAP pathway in a cancer-specific context PMID: 28114269 Detecting nuclear ErbB380kDa could constitute a useful marker of prostate cancer progression. PMID: 27191720 YAP induces the expression of epidermal growth factor (EGF) receptors (EGFR, ERBB3) and production of EGF-like ligands (HBEGF, NRG1 and NRG2); YAP induces the expression of epidermal growth factor (EGF) receptors (EGFR, ERBB3) and production of EGF-like ligands (HBEGF, NRG1 and NRG2) PMID: 25798835 In high-grade serous ovarian carcinoma (HGSC), high HER3 mRNA expression was a favorable prognostic factor for survival, while for high HER3 protein expression, a trend towards better survival was seen. A subgroup of HGSC with negative HER3 staining and negative HER3 mRNA levels showed most unfavorable survival. PMID: 27913862 ERBB3 and ERBB4 have roles in lung adenocarcinoma PMID: 26254096 Results suggest that silibinin is a potential anti-cancer drug to inhibit proliferative and invasive characteristics of the epithelial ovarian cancer (EOC) cells that exhibit an autocrine heregulin (HRG)/HER3 protein (HRG/HER3) pathway. PMID: 26482609 findings suggest that HBx promotes the progression of hepatocellular carcinoma by decreasing the stability of Nrdp1, which results in up-regulation of ErbB3 PMID: 26846102 High HER3 expression in colon cancer was associated to distal colon location and low-grade tumor. PMID: 26863446 Correlate ERBB3 gene SNPs with rheumatoid arthritis susceptibility. PMID: 25530448 Nrdp1S is a tumour suppressor that which potentiates the Nrdp1-mediated ubiquitination and degradation of ErbB3. An Nrdp1S deficiency may also be an important factor in the loss of Nrdp1. PMID: 26612725 In response to trastuzumab, both HER3 and the metalloprotease ADAM10 are simultaneously upregulated. The proteolytic activity of the latter then releases the HER3 ligand heregulin from the cell surface to activate HER3 and confer resistance to trastuzumab by inducing compensatory growth factor receptor signaling. PMID: 26863569 the identification of HER3-V855A and its functional properties for the first time clearly implicates genomic HER3 activation in the pathogenesis of lung cancer. PMID: 26689995 These data indicate that erbB3 signaling is critical for both trastuzumab and lapatinib resistances mainly through the PI-3K/Akt pathway, whereas IGF-1R-initiated Src activation results in trastuzumab resistance without affecting lapatinib sensitivity. PMID: 26621843 Data show that heat shock protein 90 (HSP90) inhibitor 17-DMAG caused loss of ret proto-oncogene protein (RET) and proto-oncogene protein erbB-3 (ERBB3) phosphorylation and lead to rapid cell death. PMID: 26595521 Data indicate the role of proto-oncogene protein erbB-3 (ErbB3) in hepatitis B virus X protein (HBx)-mediated cell survival. PMID: 26595522 our results suggest that HER3 over-expression may be associated with worse overall survival in gastric cancers PMID: 26517355 Study shows that ERBB3 is a novel regulator of beta-cell apoptosis and found rs2292239 strongly correlated with residual b-cell function and metabolic control in children with type 1 diabetes. PMID: 26450151 Authors show experimental evidence for an ErbB3 gain-of-function point mutation located in the C-lobe asymmetric dimerization interface, which shows enhanced phosphorylation at low ligand dose associated with increased kinase activity. PMID: 26378253 HER2/HER3 interaction and increased expression was linked to risk for poor outcome in lung cancer patients. PMID: 26678909 Data show that cotreatment with anti-ERBB3 proto-oncogene protein antibody seribantumab and letrozole had increased antitumor activity. PMID: 26310543 HPV 16 E2 can modulate ErbB-3 by interacting with Nrdp-1, which is involved in the regulation of this receptor, via ubiquitination and degradation. PMID: 26963794 findings show that the local 3D tumor microenvironment can trigger reprograming and switching of ErbB family members and thereby influence ErbB3-driven tumor growth PMID: 26073080 ERa-dependent expression of LRIG1 dampens ErbB3 signaling in luminal breast cancer cells, and by blocking ERa activity with fulvestrant, LRIG1 is decreased thus permitting ErbB3 accumulation, enhanced ErbB3 signaling to cell survival pathways PMID: 26148232 Data indicate that clathrin-mediated endocytosis of proto-oncogene protein erbB-3 (ErbB3) is depending on epsin-1. PMID: 26975582

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

📧 inquiry@betalifesci.com 📞 +1(201) 888-7983

Contact Us Now for Inquiries, Orders, and Questions

Recombinant Human Receptor Tyrosine-Protein Kinase Erbb-3 (ERBB3) Protein (hFc), Active

Recombinant Human Receptor Tyrosine-Protein Kinase Erbb-3 (ERBB3) Protein (hFc), Active

Product Overview

Target Details

FAQs