Recombinant Human Receptor-Type Tyrosine-Protein Phosphatase Beta (PTPRB) Protein (His-SUMO)

Name: Recombinant Human Receptor-Type Tyrosine-Protein Phosphatase Beta (PTPRB) Protein (His-SUMO)
Brand: Beta LifeScience
SKU: BLC-03675P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Receptor-Type Tyrosine-Protein Phosphatase Beta (PTPRB) Protein (His-SUMO) is produced by our E.coli expression system. This is a cytoplasmic protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P23467
Target Symbol	PTPRB
Synonyms	HPTP BETA; HPTPB; Phosphacan receptor type B; Protein tyrosine phosphatase receptor type B; Protein-tyrosine phosphatase beta; PTPB; Ptprb; PTPRB_HUMAN; R PTP BETA; R-PTP-beta; Receptor-type tyrosine-protein phosphatase beta; RPTPB; Vascular endothelial protein tyrosine phosphatase; VE-PTP
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His-SUMO
Target Protein Sequence	RQKVSHGRERPSARLSIRRDRPLSVHLNLGQKGNRKTSCPIKINQFEGHFMKLQADSNYLLSKEYEELKDVGRNQSCDIALLPENRGKNRYNNILPYDATRVKLSNVDDDPCSDYINASYIPGNNFRREYIVTQGPLPGTKDDFWKMVWEQNVHNIVMVTQCVEKGRVKCDHYWPADQDSLYYGDLILQMLSESVLPEWTIREFKICGEEQLDAHRLIRHFHYTVWPDHGVPETTQSLIQFVRTVRDYINRSPGAGPTVVHCSAGVGRTGTFIALDRILQQLDSKDSVDIYGAVHDLRLHRVHMVQTECQYVYLHQCVRDVLRARKLRSEQENPLFPIYENVNPEYHRDPVYSRH
Expression Range	1643-1997aa
Protein Length	Cytoplasmic Domain
Mol. Weight	57.4kDa
Research Area	Signal Transduction
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Plays an important role in blood vessel remodeling and angiogenesis. Not necessary for the initial formation of blood vessels, but is essential for their maintenance and remodeling. Can induce dephosphorylation of TEK/TIE2, CDH5/VE-cadherin and KDR/VEGFR-2. Regulates angiopoietin-TIE2 signaling in endothelial cells. Acts as a negative regulator of TIE2, and controls TIE2 driven endothelial cell proliferation, which in turn affects blood vessel remodeling during embryonic development and determines blood vessel size during perinatal growth. Essential for the maintenance of endothelial cell contact integrity and for the adhesive function of VE-cadherin in endothelial cells and this requires the presence of plakoglobin.
Subcellular Location	Membrane; Single-pass type I membrane protein.
Protein Families	Protein-tyrosine phosphatase family, Receptor class 3 subfamily
Database References	HGNC: 9665 OMIM: 176882 KEGG: hsa:5787 STRING: 9606.ENSP00000334928 UniGene: PMID: 27314562 STIM1-induced Ca(2+) signaling activates Pyk2 to inhibit the interaction of VE-PTP and VE-cadherin and hence increase endothelial permeability. PMID: 28385807 Results provide evidence that PTPRB and PLCG1 mutations are driving events in a subset of secondary angiosarcomas. PMID: 24795022 VE-PTP activates TIE2 and stabilizes retinal and choroidal blood vessels PMID: 25180601 these results suggest that the polarized redistribution of VE-PTP in response to shear stress plays an important role in the regulation of endothelial cells function by blood flow. PMID: 24451369 The endothelial phosphatase PTPRB, a negative regulator of vascular growth factor tyrosine kinases, harbored predominantly truncating mutations in 10 of 39 angiosarcoma tumors. PMID: 24633157 zinc(II) ions regulate receptor protein-tyrosine phosphatase beta activity at picomolar concentrations. PMID: 22275360 vascular endothelial protein tyrosine phosphatase contributes to endothelial morphogenesis. Silencing of VE-PTP expression was accompanied by increased VEGF receptor-2 tyrosine phosphorylation and activation of downstream signaling pathways. PMID: 19136612 Suggest that VE-PTP, in cooperation with integrins, regulates the spreading and migration of endothelial cells during angiogenesis. PMID: 20301196 The PTP1B has been observed over expressed in human breast cancer patients, suggesting its role in cell proliferation. PMID: 15638728 the Ser127Gly polymorphism in PTPRB is associated with substance abuse vulnerability in three independent case-control samples, but was not associated with alcoholism in Japanese subjects PMID: 18361428 These results reveal a novel role for HPTPbeta in modulating Ang-1-Tie2 signaling and endothelial cell survival. PMID: 19116766

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.