Recombinant Human Receptor-Binding Cancer Antigen Expressed On Siso Cells (EBAG9) Protein (His-SUMO)

Name: Recombinant Human Receptor-Binding Cancer Antigen Expressed On Siso Cells (EBAG9) Protein (His-SUMO)
Brand: Beta LifeScience
SKU: BLC-10168P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Receptor-Binding Cancer Antigen Expressed On Siso Cells (EBAG9) Protein (His-SUMO) is produced by our E.coli expression system. This is a cytoplasmic protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	O00559
Target Symbol	EBAG9
Synonyms	BAG9; Cancer associated surface antigen; Cancer associated surface antigen RCAS1; Cancer-associated surface antigen RCAS1; EB9; EBAG 9; EBAG9; Estrogen receptor binding fragment associated gene 9 protein; Estrogen receptor binding site associated antigen 9; estrogen receptor binding site associated; antigen; 9; Estrogen receptor-binding fragment-associated gene 9 protein; PDAF; RCAS 1; RCAS1; RCAS1_HUMAN; Receptor binding cancer antigen expressed on SiSo cells; Receptor-binding cancer antigen expressed on SiSo cells
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His-SUMO
Target Protein Sequence	RSGRGRKLSGDQITLPTTVDYSSVPKQTDVEEWTSWDEDAPTSVKIEGGNGNVATQQNSLEQLEPDYFKDMTPTIRKTQKIVIKKREPLNFGIPDGSTGFSSRLAATQDLPFIHQSSELGDLDTWQENTNAWEEEEDAAWQAEEVLRQQKLADREKRAAEQQRKKMEKEAQRLMKKEQNKIGVKLS
Expression Range	28-213aa
Protein Length	Cytoplasmic Domain
Mol. Weight	37.2kDa
Research Area	Apoptosis
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	May participate in suppression of cell proliferation and induces apoptotic cell death through activation of interleukin-1-beta converting enzyme (ICE)-like proteases.
Subcellular Location	Golgi apparatus membrane; Single-pass type III membrane protein. Note=According to PubMed:10426319, it also exists as a soluble form which has the same biological activities. The existence of such soluble form is however uncertain.
Database References	HGNC: 3123 OMIM: 605772 KEGG: hsa:9166 STRING: 9606.ENSP00000337675 UniGene: PMID: 26438059 RCAS1 seems to be involved in creating tumor-induced inflammation in the tumor and its microenvironment PMID: 25773455 High EBAG9 expression is associated with malignant pleural effusion in patients with lung cancer. PMID: 24720371 Findings suggest that the histological effect of increased RCAS1 expression depends on its cellular source and that RCAS1 expression itself is a component of various signaling pathways in urothelial bladder cancer cells. PMID: 25674852 suggests that RCAS1 has an apoptotic function via membranous/soluble expression pattern in OSCC cells. RCAS1 may thus affect tumor escape from immune surveillance in OSCC by inducing apoptosis PMID: 24885040 RCAS1 could be a useful immunohistochemical biomarker, indicating not only tumor aggressiveness but also a poorer prognosis for patients with NSCLC. PMID: 24815841 High EBAG9 expression is associated with tamoxifen resistance in breast cancer. PMID: 24119785 sRCAS1 levels could have a clinical value for the diagnosis and management of lung cancer and could be used as a new tumor marker of lung cancer. PMID: 23881387 RCAS1 may play an important role in the phenomenon of tumor escape from host immunological surveillance and in creating the immune tolerance for the tumor cells, as well as in the tumor microenvironment. PMID: 23164108 The membrane molecule RCAS1 induces immune cell apoptosis via the RCAS1-RCAS1R pathway. PMID: 23563217 The intensity of the suppressive profile of the cervical cancer microenvironment indicated by the presence of both RCAS1 and B7H4 on the front of the tumor and in the macrophages and fibroblasts infiltrating the cancer stroma PMID: 22530960 RCAS1 protein may participate in thyroid neoplastic transformation and could be considered as a useful biomarker to improve diagnostic scrutiny. PMID: 22460085 The immunoreactivity of RCAS1 on the cells present in the ovarian cancer microenvironment, was analysed. PMID: 21845402 Data suggest that RCAS1 may be involved in the early stages of tumor progression in mobile tongue squamous cell carcinoma. PMID: 21804460 We observed a statistically significant increase in the RCAS1-positive macrophage infiltration within the microenvironment of the molar lesions in patients with partial hydatidiform mole in comparison with those who exhibited complete hydatidiform mole. PMID: 20645939 analyzed RCAS-1 as a biomarker in the serum of patients with head and neck squamous cell carcinoma PMID: 20571277 EBAG9 acts as a negative regulator of a COPI-dependent ER-to-Golgi transport pathway in epithelial cells and shows pathogenetic principle in which interference with intracellular membrane trafficking results in the emergence of a tumor-associated glycome PMID: 20570965 RCAS1 can be used as a serum tumor marker for diagnosis of pancreatic cancer. PMID: 19957811 the RCAS1 putative receptor-expressing chronic myelogenous leukemia cell line K562 was co-cultured with SiSo, MCF-7, or soluble RCAS1 to follow RCAS1 secretion in apoptosis initiation PMID: 20079734 NASP and RCAS1 proteins were more frequently expressed in ovarian cancer tissues than with normal ovarian tissue and serous cystadenomas and MRE11 was less frequently expressed PMID: 20164540 Overrepresentation of EBAG9 may play a specific role in early stages of breast carcinogenesis. PMID: 11705872 High expression of tumor-associated antigen RCAS1 in pancreatic ductal adenocarcinoma is an unfavorable prognostic marker PMID: 11992411 RCAS1 is associated with ductal breast cancer progression PMID: 12054692 modulates surface expression of tumor-associated, normally cryptic O-linked glycan structures and contributes indirectly to the antigenicity of tumor cells PMID: 12672804 RCAS1 expressed on macrophages may play an important role in the induction of activated T-cell apoptosis in cases of HNL PMID: 12774924 Overexpression of EBAG9 is correlated with advanced pathologic stages of prostate cancer PMID: 12845666 RCAS1 may have role endometrial cancer invasiveness; overexpression associated with significantly poorer prognosis PMID: 12888828 RCAS1 gene or protein expression may not correlate with tumor progression in esophageal squamous cell carcinoma PMID: 14534714 The mean survival of patients who had primary hepatocellular carcinoma with high RCAS1 protein expression was significantly longer than that of patients with low expression. PMID: 14981953 wide distribution of EBAG9 and its relation to advanced disease suggest that this protein may play important roles in epithelial ovarian cancer PMID: 15164121 RCAS1 expression might be associated with progression of oral squamous cell carcinoma PMID: 15254686 Serum RCAS1 appears to be valuable as a diagnostic index for biliary carcinomas, as well as for evaluating the progression of cancers during therapy. PMID: 15460847 EBAG9 and Snapin have roles in controlling exocytosis processes PMID: 15635093 Macrophages may negatively regulate erythropoiesis at least in part through the production of RCAS1 molecules. PMID: 15813909 EBAG9 is a crucial regulator of tumor progression and a potential prognostic marker for RCC. PMID: 15867365 the estrogen-inducible EBAG9 gene-product and the 22-1-1 defined antigen are structurally and functionally separate antigens PMID: 15904507 RCAS1 expression is informative for the follow-up of malignant mesothelioma patients and sRCAS1 in pleural fluid may be useful for the diagnosis of malignant mesothelioma. PMID: 16012715 RCAS1 may contribute to acquisition of malignant uterine cervical phenotypic characteristics including invasion, metastasis, and tumor growth via connective tissue remodeling. PMID: 16112176 RCAS1 and CAP may play a role in the downregulation of the maternal immune response during pregnancy and may participate in the initiation of the labor PMID: 16113565 distribution of RCAS1 expression in normal female genital organs; significant positive correlation between age and RCAS1 expression; RCAS1 may affect metaplastic processes and tumor progression PMID: 16175077 expression of RCAS1 is correlated with recurrence not only in carcinomas, but also in mesenchymal tumors PMID: 16211275 metastatic lymph nodes from bile duct, gastric, colon and pancreatic cancer were investigated for RCAS1 expression PMID: 16273616 RCAS1 expression in gliomas may play roles in tumor progression and tumor immune escape. PMID: 16595162 The expression of RCAS1 by endometrial cells may favor the persistence of these cells in ectopic localization both in scar following cesarean section and in ovarian endometriosis. PMID: 16907986 Significantly higher RCAS1 expression was noticed in tumor in comparison to stroma in patients with the presence of lymph nodes metastases. No such difference was observed in patients without the metastases. PMID: 17187007 RCAS1 expression was simultaneous to the infiltration of activated immunological cells of tumor environment as well as decidua. The activity of immunological cells was selectively suppressed. PMID: 17187008 High-level expression of RCAS1 is involved in the malignant transformation of endometrium, and RCAS1 coexpression with ER-alpha may be associated with development and metastasis of endometrial carcinoma PMID: 17466050 The expression of RCAS1 in cervical cancer is significantly increased, and has correlation with malignant degree of cervical carcinoma. Some RCAS1-positive cervical cancer tissues are infected by HPV16. PMID: 17562271 possible role of the RCAS1 protein in the development of pre-eclampsia through an immunological pathway. PMID: 17604121 the drop of the RCAS1 level, which could be a result of an insufficiency of the compensatory immune response mechanisms in tubal mucosa (although these mechanisms are simultaneously preserved in endometrium), leads to tubal perforation. PMID: 17717421

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.