Recombinant Human Ras-Specific Guanine Nucleotide-Releasing Factor Ralgps1 (RALGPS1) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-09853P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Ras-Specific Guanine Nucleotide-Releasing Factor Ralgps1 (RALGPS1) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-09853P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Ras-Specific Guanine Nucleotide-Releasing Factor Ralgps1 (RALGPS1) Protein (His-SUMO) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | Q5JS13 |
| Target Symbol | RALGPS1 |
| Synonyms | RALGPS1; KIAA0351; RALGEF2; Ras-specific guanine nucleotide-releasing factor RalGPS1; Ral GEF with PH domain and SH3-binding motif 1; Ral guanine nucleotide exchange factor 2; RalGEF 2; RalA exchange factor RalGPS1 |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-6His-SUMO |
| Target Protein Sequence | MYKRNGLMASVLVTSATPQGSSSSDSLEGQSCDYASKSYDAVVFDVLKVTPEEFASQITLMDIPVFKAIQPEELASCGWSKKEKHSLAPNVVAFTRRFNQVSFWVVREILTAQTLKIRAEILSHFVKIAKKLLELNNLHSLMSVVSALQSAPIFRLTKTWALLNRKDKTTFEKLDYLMSKEDNYKRTREYIRSLKMVPSIPYLGIYLLDLIYIDSAYPASGSIMENEQRSNQMNNILRIIADLQVSCSYDHLTTLPHVQKYLKSVRYIEELQKFVEDDNYKLSLRIEPGSSSPRLVSSKEDLAAM |
| Expression Range | 1-305aa |
| Protein Length | Full Length of Isoform 4 |
| Mol. Weight | 50.7kDa |
| Research Area | Signal Transduction |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Guanine nucleotide exchange factor (GEF) for the small GTPase RALA. May be involved in cytoskeletal organization. Guanine nucleotide exchange factor for. |
| Subcellular Location | Cytoplasm. Cell membrane. Note=Associates with membranes through the PH domain. |
| Database References |
