Recombinant Human Ras-Related Protein Rab-1A (RAB1A) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-02359P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Ras-Related Protein Rab-1A (RAB1A) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-02359P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Ras-Related Protein Rab-1A (RAB1A) Protein (GST) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | P62820 |
| Target Symbol | RAB1A |
| Synonyms | GTP binding protein RAB 1A; mKIAA3012; RAB 1; Rab 1A; RAB1; RAB1, member RAS oncogene family; Rab1A; RAB1A member RAS oncogene family; RAB1A_HUMAN; Ras related protein Rab 1A; Ras-associated protein RAB1; Ras-related protein Rab-1A; YPT1; YPT1 related protein; YPT1-related protein |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-GST |
| Target Protein Sequence | SSMNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQSGGGCC |
| Expression Range | 2-205aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 49.5kDa |
| Research Area | Transport |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different sets of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. RAB1A regulates vesicular protein transport from the endoplasmic reticulum (ER) to the Golgi compartment and on to the cell surface, and plays a role in IL-8 and growth hormone secretion. Regulates the level of CASR present at the cell membrane. Plays a role in cell adhesion and cell migration, via its role in protein trafficking. Plays a role in autophagosome assembly and cellular defense reactions against pathogenic bacteria. Plays a role in microtubule-dependent protein transport by early endosomes and in anterograde melanosome transport. |
| Subcellular Location | Golgi apparatus. Endoplasmic reticulum. Early endosome. Cytoplasm, cytosol. Membrane. Melanosome. |
| Protein Families | Small GTPase superfamily, Rab family |
| Database References | HGNC: 9758 OMIM: 179508 KEGG: hsa:5861 STRING: 9606.ENSP00000387286 UniGene: PMID: 29301870 |
