Recombinant Human Ras-Related C3 Botulinum Toxin Substrate 3 (RAC3) Protein (GST)

Name: Recombinant Human Ras-Related C3 Botulinum Toxin Substrate 3 (RAC3) Protein (GST)
Brand: Beta LifeScience
SKU: BLC-09192P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Product Overview

Description	Recombinant Human Ras-Related C3 Botulinum Toxin Substrate 3 (RAC3) Protein (GST) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P60763
Target Symbol	RAC3
Synonyms	OTTMUSP00000004488; p21 Rac3; p21-Rac3; Rac1B; RAC3; RAC3_HUMAN; RAS related C3 botulinum substrate 3; Ras related C3 botulinum toxin substrate 3 (rho family small GTP binding protein Rac3) ; Ras related C3 botulinum toxin substrate 3 (rho family; small GTP binding protein Rac3); Ras-related C3 botulinum toxin substrate 3; Rho family small GTP binding protein Rac3; RP23-84C12.18
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-GST
Target Protein Sequence	MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPHTPILLVGTKLDLRDDKDTIERLRDKKLAPITYPQGLAMAREIGSVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKPGKKC
Expression Range	1-192aa
Protein Length	Full Length
Mol. Weight	48.0kDa
Research Area	Signal Transduction
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Plasma membrane-associated small GTPase which cycles between an active GTP-bound and inactive GDP-bound state. In active state binds to a variety of effector proteins to regulate cellular responses, such as cell spreading and the formation of actin-based protusions including lamellipodia and membrane ruffles. Promotes cell adhesion and spreading on fibrinogen in a CIB1 and alpha-IIb/beta3 integrin-mediated manner.
Subcellular Location	Cytoplasm. Endomembrane system. Cell projection, lamellipodium. Cytoplasm, perinuclear region. Cell membrane. Cytoplasm, cytoskeleton. Note=Membrane-associated when activated. Colocalizes with NRBP to endomembranes and at the cell periphery in lamellipodia. Colocalized with CIB1 in the perinuclear area and at the cell periphery.
Protein Families	Small GTPase superfamily, Rho family
Database References	HGNC: 9803 OMIM: 602050 KEGG: hsa:5881 STRING: 9606.ENSP00000304283 UniGene: Hs.45002
Tissue Specificity	Highest levels in brain, also detected in heart, placenta and pancreas.

Gene Functions References

Rac3 regulates breast cancer invasion and metastasis by controlling adhesion and matrix degradation. PMID: 29061650
Rac3 regulates the biological behaviors of lung adenocarcinoma through a mechanism of downregulating CCND1, MYC, and TFDP1 of cell cycle pathway. PMID: 27402308
Efficient silencing of Rac3 strongly inhibited A549 cell proliferation. PMID: 25854406
Collectively these data unveil that FBXL19 functions as an antagonist of Rac3 by regulating its stability and regulates the TGFbeta1-induced E-cadherin down-regulation. PMID: 24684802
Report role of Rac3 in breast cancer aggressiveness and show the potential usefulness of Rac3 depletion in breast cancer therapy. PMID: 23388133
Rac1b forms a complex with NADPH oxidase and promotes the production of reactive oxygen species, expression of Snail, and activation of the epithelial-mesenchymal transition program. PMID: 22918955
Activation of epithelial-mesenchymal transition by MMP-induced expression of Rac1b gave rise to lung adenocarcinoma. PMID: 22786680
Rac3 GTPase has a role in the regulation of autophagy PMID: 21852230
RAC3 is a novel ERalpha co-activator that promotes cell migration and has prognostic value for ERalpha-positive breast cancer metastasis. PMID: 21217774
Our data is the first report of the frequency of Rac3 overexpression and mutation in human brain tumors. Overexpression may be associated with aggressive tumor behavior PMID: 15993075
RAC1 and RAC3 have opposing functions in cell adhesion and differentiation in neuronal cells. PMID: 17244648
Data demonstrate that Rac3 shares with Rac1 the ability to interfere with cadherin-mediated adhesion. PMID: 18319303
Rac3 inhibits adhesion and differentiation of neuronal cells by modifying GIT1 downstream signaling. PMID: 19494130

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.