Recombinant Human Ragulator Complex Protein Lamtor3 (LAMTOR3) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-08165P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Ragulator Complex Protein Lamtor3 (LAMTOR3) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-08165P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Ragulator Complex Protein Lamtor3 (LAMTOR3) Protein (GST) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | Q9UHA4 |
| Target Symbol | LAMTOR3 |
| Synonyms | LAMTOR3; Late endosomal/lysosomal adaptor and MAPK and MTOR activator 3; LTOR3_HUMAN; MAP2K1IP1; MEK binding partner 1; MEK partner 1 ; MEK-binding partner 1; Mitogen activated protein kinase kinase 1 interacting protein 1; Mitogen-activated protein kinase kinase 1-interacting protein 1; Mitogen-activated protein kinase scaffold protein 1; Mp1; Ragulator complex protein LAMTOR3 |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-GST |
| Target Protein Sequence | MADDLKRFLYKKLPSVEGLHAIVVSDRDGVPVIKVANDNAPEHALRPGFLSTFALATDQGSKLGLSKNKSIICYYNTYQVVQFNRLPLVVSFIASSSANTGLIVSLEKELAPLFEELRQVVEVS |
| Expression Range | 1-124aa |
| Protein Length | Full Length |
| Mol. Weight | 40.6kDa |
| Research Area | Signal Transduction |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | As part of the Ragulator complex it is involved in amino acid sensing and activation of mTORC1, a signaling complex promoting cell growth in response to growth factors, energy levels, and amino acids. Activated by amino acids through a mechanism involving the lysosomal V-ATPase, the Ragulator functions as a guanine nucleotide exchange factor activating the small GTPases Rag. Activated Ragulator and Rag GTPases function as a scaffold recruiting mTORC1 to lysosomes where it is in turn activated. Adapter protein that enhances the efficiency of the MAP kinase cascade facilitating the activation of MAPK2. |
| Subcellular Location | Late endosome membrane; Peripheral membrane protein; Cytoplasmic side. |
| Protein Families | LAMTOR3 family |
| Database References | HGNC: 15606 OMIM: 603296 KEGG: hsa:8649 STRING: 9606.ENSP00000424183 UniGene: PMID: 28830458 |
