Recombinant Human Putative Rna-Binding Protein 3 (RBM3) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-10908P

Greater than 90% as determined by SDS-PAGE.
Recombinant Human Putative Rna-Binding Protein 3 (RBM3) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-10908P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Putative Rna-Binding Protein 3 (RBM3) Protein (His-SUMO) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | P98179 |
Target Symbol | RBM3 |
Synonyms | 2600016C11Rik; IS1 RNPL; MGC105811; MGC118410; OTTHUMP00000025800; OTTHUMP00000025802; OTTMUSP00000019634; OTTMUSP00000019635; OTTMUSP00000019636; Putative RNA binding protein 3; Putative RNA-binding protein 3; Rbm3; RBM3_HUMAN; RNA binding motif (RNP1; RRM) protein 3; RNA binding motif protein 3; RNA-binding motif protein 3; RNA-binding protein 3; RNPL; RP23-27I6.7 |
Species | Homo sapiens (Human) |
Expression System | E.coli |
Tag | N-6His-SUMO |
Target Protein Sequence | MSSEEGKLFVGGLNFNTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHASVAMRAMNGESLDGRQIRVDHAGKSARGTRGGGFGAHGRGRSYSRGGGDQGYGSGRYYDSRPGGYGYGYGRSRDYNGRNQGGYDRYSGGNYRDNYDN |
Expression Range | 1-157aa |
Protein Length | Full Length |
Mol. Weight | 33.2kDa |
Research Area | Epigenetics And Nuclear Signaling |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Cold-inducible mRNA binding protein that enhances global protein synthesis at both physiological and mild hypothermic temperatures. Reduces the relative abundance of microRNAs, when overexpressed. Enhances phosphorylation of translation initiation factors and active polysome formation. |
Subcellular Location | Nucleus. Cytoplasm. Cell projection, dendrite. |
Database References |
Gene Functions References
- Results showed that high RBM3 expression in gastric cancer is mainly found in intestinal-type of Lauren grade and is associated with longer overall survival time. PMID: 29263314
- Overexpression of RBM3 rescued SH-SY5Y cells from UV-induced apoptosis. PMID: 28831692
- RBM3 is overexpressed in bipolar disorder patients responding to lithium treatment compared to non-responders. PMID: 28616776
- Loss of RBM3 expression is an unfavourable prognostic marker in colorectal cancers (CRCs), and is linked to right-sided tumour localization. PMID: 25922889
- High RBM3 expression is an independent predictor of prolonged survival in metastatic colorectal cancer patients. PMID: 28800641
- Results show that RBM3 overexpression results in increased stemness in colon cancer cells, and inactivation of GSK3 through phosphorylation, thereby enhancing b-catenin signaling activity the colorectal cancer cells. PMID: 26331352
- Low RBM3 expression is associated with colon Cancer. PMID: 28373441
- Studies showed RBM3 as one of the important cold shock protein with critical roles in rapid cell adaption to the alterations of the environmental stress. Also, RBM3 plays an important role in neuroprotection, anti-apoptotic functions, cell proliferation as well as its function as proto-oncogene.[review] PMID: 27364162
- The results indicate the existence of a negative feedback loop that regulates fever via reduced RBM3 levels and increased expression of miR-142-5p and miR-143. PMID: 26825461
- Low RBM3 immunoexpression is associated with urothelial carcinoma of the bladder. PMID: 26577765
- RBM3 may be a potential biomarker for treatment stratification in patients with metastatic non-seminomatous germ cell tumours. PMID: 25811459
- High RBM3 expression is an independent prognostic marker in prostate cancer. PMID: 24380696
- The data suggest that the overexpression of RBM3 may serve as an important molecular mechanism underlying astrocytic carcinogenesis. PMID: 23673116
- A novel role of RBM3 in linking stress-regulated RNA splicing to tumorigenesis. PMID: 23667174
- Loss of RBM3 expression is associated with more aggressive tumors and poorer prognosis of urothelial bladder cancer. Findings may indicate that loss of RBM3 expression results in a phenotype more prone to metastatic spread than local aggressiveness. PMID: 23565664
- the inverse association and prognostic impact of MCM3 and RBM3 expression indicate a possible interaction of these proteins in melanoma progression PMID: 22805320
- high tumor-specific nuclear expression of RBM3 is an independent predictor of good prognosis in colorectal cancer PMID: 21956899
- high nuclear expression of RBM3 in prostate cancer is associated with a prolonged time to disease progression PMID: 21955582
- RBM3 is down-regulated in metastatic melanoma and high nuclear RBM3 expression in the primary tumour is an independent marker of a prolonged overal survival. PMID: 21777469
- RBM3 may be a useful prognostic and treatment predictive marker in epithelial ovarian cancer. PMID: 20727170
- RBM3 is a critical factor providing cellular survival advantages in an adverse microenvironment presumably by restoring translation efficacy PMID: 19770690
- Nuclear RBM3 is an independent favorable prognostic factor in breast cancer, and seems to have a specific role in estrogen receptor-positive tumors. PMID: 19734850
- RBM3 and CIRP are adaptatively expressed in response to hypoxia by a mechanism that involves neither HIF-1 nor mitochondria PMID: 15075239
- From these results, it seems that the X-chromosome, through its RBM genes, plays a formerly unknown role in the regulation of programmed cell death (apoptosis) in breast cancer. PMID: 16552754
- the RNA stabilizing and translation regulatory protein RBM3 is a novel proto-oncogene that induces transformation when overexpressed and is essential for cells to progress through mitosis. PMID: 18427544
- pharmacological modulation of RBM3 and CIRBP may represent novel therapeutic approaches for prostate cancer. PMID: 19277990