Recombinant Human Putative Rna-Binding Protein 3 (RBM3) Protein (His)

Beta LifeScience SKU/CAT #: BLC-09755P
Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SDS-PAGE.

Recombinant Human Putative Rna-Binding Protein 3 (RBM3) Protein (His)

Beta LifeScience SKU/CAT #: BLC-09755P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Product Overview

Description Recombinant Human Putative Rna-Binding Protein 3 (RBM3) Protein (His) is produced by our Yeast expression system. This is a full length protein.
Purity Greater than 90% as determined by SDS-PAGE.
Uniprotkb P98179
Target Symbol RBM3
Synonyms 2600016C11Rik; IS1 RNPL; MGC105811; MGC118410; OTTHUMP00000025800; OTTHUMP00000025802; OTTMUSP00000019634; OTTMUSP00000019635; OTTMUSP00000019636; Putative RNA binding protein 3; Putative RNA-binding protein 3; Rbm3; RBM3_HUMAN; RNA binding motif (RNP1; RRM) protein 3; RNA binding motif protein 3; RNA-binding motif protein 3; RNA-binding protein 3; RNPL; RP23-27I6.7
Species Homo sapiens (Human)
Expression System Yeast
Tag N-6His
Target Protein Sequence MSSEEGKLFVGGLNFNTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHASVAMRAMNGESLDGRQIRVDHAGKSARGTRGGGFGAHGRGRSYSRGGGDQGYGSGRYYDSRPGGYGYGYGRSRDYNGRNQGGYDRYSGGNYRDNYDN
Expression Range 1-157aa
Protein Length Full Length
Mol. Weight 19.2kDa
Research Area Epigenetics And Nuclear Signaling
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Cold-inducible mRNA binding protein that enhances global protein synthesis at both physiological and mild hypothermic temperatures. Reduces the relative abundance of microRNAs, when overexpressed. Enhances phosphorylation of translation initiation factors and active polysome formation.
Subcellular Location Nucleus. Cytoplasm. Cell projection, dendrite.
Database References

Gene Functions References

  1. Results showed that high RBM3 expression in gastric cancer is mainly found in intestinal-type of Lauren grade and is associated with longer overall survival time. PMID: 29263314
  2. Overexpression of RBM3 rescued SH-SY5Y cells from UV-induced apoptosis. PMID: 28831692
  3. RBM3 is overexpressed in bipolar disorder patients responding to lithium treatment compared to non-responders. PMID: 28616776
  4. Loss of RBM3 expression is an unfavourable prognostic marker in colorectal cancers (CRCs), and is linked to right-sided tumour localization. PMID: 25922889
  5. High RBM3 expression is an independent predictor of prolonged survival in metastatic colorectal cancer patients. PMID: 28800641
  6. Results show that RBM3 overexpression results in increased stemness in colon cancer cells, and inactivation of GSK3 through phosphorylation, thereby enhancing b-catenin signaling activity the colorectal cancer cells. PMID: 26331352
  7. Low RBM3 expression is associated with colon Cancer. PMID: 28373441
  8. Studies showed RBM3 as one of the important cold shock protein with critical roles in rapid cell adaption to the alterations of the environmental stress. Also, RBM3 plays an important role in neuroprotection, anti-apoptotic functions, cell proliferation as well as its function as proto-oncogene.[review] PMID: 27364162
  9. The results indicate the existence of a negative feedback loop that regulates fever via reduced RBM3 levels and increased expression of miR-142-5p and miR-143. PMID: 26825461
  10. Low RBM3 immunoexpression is associated with urothelial carcinoma of the bladder. PMID: 26577765
  11. RBM3 may be a potential biomarker for treatment stratification in patients with metastatic non-seminomatous germ cell tumours. PMID: 25811459
  12. High RBM3 expression is an independent prognostic marker in prostate cancer. PMID: 24380696
  13. The data suggest that the overexpression of RBM3 may serve as an important molecular mechanism underlying astrocytic carcinogenesis. PMID: 23673116
  14. A novel role of RBM3 in linking stress-regulated RNA splicing to tumorigenesis. PMID: 23667174
  15. Loss of RBM3 expression is associated with more aggressive tumors and poorer prognosis of urothelial bladder cancer. Findings may indicate that loss of RBM3 expression results in a phenotype more prone to metastatic spread than local aggressiveness. PMID: 23565664
  16. the inverse association and prognostic impact of MCM3 and RBM3 expression indicate a possible interaction of these proteins in melanoma progression PMID: 22805320
  17. high tumor-specific nuclear expression of RBM3 is an independent predictor of good prognosis in colorectal cancer PMID: 21956899
  18. high nuclear expression of RBM3 in prostate cancer is associated with a prolonged time to disease progression PMID: 21955582
  19. RBM3 is down-regulated in metastatic melanoma and high nuclear RBM3 expression in the primary tumour is an independent marker of a prolonged overal survival. PMID: 21777469
  20. RBM3 may be a useful prognostic and treatment predictive marker in epithelial ovarian cancer. PMID: 20727170
  21. RBM3 is a critical factor providing cellular survival advantages in an adverse microenvironment presumably by restoring translation efficacy PMID: 19770690
  22. Nuclear RBM3 is an independent favorable prognostic factor in breast cancer, and seems to have a specific role in estrogen receptor-positive tumors. PMID: 19734850
  23. RBM3 and CIRP are adaptatively expressed in response to hypoxia by a mechanism that involves neither HIF-1 nor mitochondria PMID: 15075239
  24. From these results, it seems that the X-chromosome, through its RBM genes, plays a formerly unknown role in the regulation of programmed cell death (apoptosis) in breast cancer. PMID: 16552754
  25. the RNA stabilizing and translation regulatory protein RBM3 is a novel proto-oncogene that induces transformation when overexpressed and is essential for cells to progress through mitosis. PMID: 18427544
  26. pharmacological modulation of RBM3 and CIRBP may represent novel therapeutic approaches for prostate cancer. PMID: 19277990

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

Recently viewed