Recombinant Human Putative C-Type Lectin-Like Domain Family 1 (CLECL1) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-01404P
Greater than 85% as determined by SDS-PAGE.
Recombinant Human Putative C-Type Lectin-Like Domain Family 1 (CLECL1) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-01404P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Putative C-Type Lectin-Like Domain Family 1 (CLECL1) Protein (His&Myc) is produced by our Baculovirus expression system. This is a protein fragment. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Uniprotkb | Q8IZS7 |
| Target Symbol | CLECL1 |
| Synonyms | Dendritic cell-associated lectin 1 |
| Species | Homo sapiens (Human) |
| Expression System | Baculovirus |
| Tag | N-10His&C-Myc |
| Target Protein Sequence | KTVRTSPLELAFPLQRSVSFNFSTVHKSCPAKDWKVHKGKCYWIAETKKSWNKSQNDCAINNSYLMVIQDITAMVRFNI |
| Expression Range | 89-167aa |
| Protein Length | Partial |
| Mol. Weight | 13 kDa |
| Research Area | Immunology |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | May function in mediating immune cell-cell interactions. May act as a T-cell costimulatory molecule, enhancing anti-CD3-induced proliferation. May play a role in the interaction of dendritic cells with T-cells and the cells of the adaptive immune response. |
| Subcellular Location | Cell membrane; Single-pass type II membrane protein. |
| Database References | HGNC: 24462 OMIM: 607467 KEGG: hsa:160365 STRING: 9606.ENSP00000331766 UniGene: PMID: 19648166 |
