Recombinant Human Pulmonary Surfactant-Associated Protein D (SFTPD) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-10824P
Greater than 90% as determined by SDS-PAGE.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) SFTPD.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) SFTPD.
Recombinant Human Pulmonary Surfactant-Associated Protein D (SFTPD) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-10824P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Pulmonary Surfactant-Associated Protein D (SFTPD) Protein (His) is produced by our Yeast expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | P35247 |
| Target Symbol | SFTPD |
| Synonyms | COLEC 7; COLEC7; Collectin-7; Collectin7; Lung surfactant protein D; PSP D; PSP-D; PSP-D Surfactant protein D; PSPD; Pulmonary surfactant apoprotein; Pulmonary surfactant associated protein D; Pulmonary surfactant associated protein PSP-D; Pulmonary surfactant-associated protein D; SFTP 4; SFTP4; SFTPD; SFTPD_HUMAN; SP D; SP-D; Surfactant associated protein pulmonary 4; Surfactant protein D; Surfactant pulmonary associated protein D |
| Species | Homo sapiens (Human) |
| Expression System | Yeast |
| Tag | N-6His |
| Target Protein Sequence | AEMKTYSHRTMPSACTLVMCSSVESGLPGRDGRDGREGPRGEKGDPGLPGAAGQAGMPGQAGPVGPKGDNGSVGEPGPKGDTGPSGPPGPPGVPGPAGREGPLGKQGNIGPQGKPGPKGEAGPKGEVGAPGMQGSAGARGLAGPKGERGVPGERGVPGNTGAAGSAGAMGPQGSPGARGPPGLKGDKGIPGDKGAKGESGLPDVASLRQQVEALQGQVQHLQAAFSQYKKVELFPNGQSVGEKIFKTAGFVKPFTEAQLLCTQAGGQLASPRSAAENAALQQLVVAKNEAAFLSMTDSKTEGKFTYPTGESLVYSNWAPGEPNDDGGSEDCVEIF |
| Expression Range | 21–375aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 35.2kDa |
| Research Area | Cancer |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Contributes to the lung's defense against inhaled microorganisms, organic antigens and toxins. Interacts with compounds such as bacterial lipopolysaccharides, oligosaccharides and fatty acids and modulates leukocyte action in immune response. May participate in the extracellular reorganization or turnover of pulmonary surfactant. Binds strongly maltose residues and to a lesser extent other alpha-glucosyl moieties. |
| Subcellular Location | Secreted, extracellular space, extracellular matrix. Secreted, extracellular space, surface film. |
| Protein Families | SFTPD family |
| Database References | HGNC: 10803 OMIM: 178635 KEGG: hsa:6441 STRING: 9606.ENSP00000361366 UniGene: PMID: 29425774 |
