Recombinant Human Pulmonary Surfactant-Associated Protein A1 (SFTPA1) Protein (His)

Name: Recombinant Human Pulmonary Surfactant-Associated Protein A1 (SFTPA1) Protein (His)
Brand: Beta LifeScience
SKU: BLC-10391P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) SFTPA1.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Pulmonary Surfactant-Associated Protein A1 (SFTPA1) Protein (His) is produced by our Yeast expression system. This is a full length protein.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	Q8IWL2
Target Symbol	SFTPA1
Synonyms	SFTPA1; COLEC4; PSAP; SFTP1; SFTPA; SFTPA1B; Pulmonary surfactant-associated protein A1; PSP-A; PSPA; SP-A; SP-A1; 35 kDa pulmonary surfactant-associated protein; Alveolar proteinosis protein; Collectin-4
Species	Homo sapiens (Human)
Expression System	Yeast
Tag	N-6His
Target Protein Sequence	EVKDVCVGSPGIPGTPGSHGLPGRDGRDGLKGDPGPPGPMGPPGEMPCPPGNDGLPGAPGIPGECGEKGEPGERGPPGLPAHLDEELQATLHDFRHQILQTRGALSLQGSIMTVGEKVFSSNGQSITFDAIQEACARAGGRIAVPRNPEENEAIASFVKKYNTYAYVGLTEGPSPGDFRYSDGTPVNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRNCLYSRLTICEF
Expression Range	21-248aa
Protein Length	Full Length of Mature Protein
Mol. Weight	26.2 kDa
Research Area	Cell Biology
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	In presence of calcium ions, it binds to surfactant phospholipids and contributes to lower the surface tension at the air-liquid interface in the alveoli of the mammalian lung and is essential for normal respiration. Enhances the expression of MYO18A/SP-R210 on alveolar macrophages.; (Microbial infection) Recognition of M.tuberculosis by dendritic cells may occur partially via this molecule. Can recognize, bind, and opsonize pathogens to enhance their elimination by alveolar macrophages.
Subcellular Location	Secreted, extracellular space, extracellular matrix. Secreted, extracellular space, surface film.
Protein Families	SFTPA family
Database References	HGNC: 10798 OMIM: 178500 KEGG: hsa:653509 STRING: 9606.ENSP00000397082 UniGene: PMID: 30074012 TGF beta markedly decreased expression of SP-A, SP-B, SP-C, fatty acid synthase, and the phospholipid transporter ABCA3. However, TGF beta increased protein levels of SP-D with little change in mRNA levels. PMID: 29621540 this study shows that concentrations of SP-A are associated with polarization of macrophages in pleural effusions of non-small cell lung cancer PMID: 29111316 the SPA and SPD levels in EBC were correlated with lung function, which contributed to COPD diagnosis. PMID: 28791362 Data (including data from studies using transgenic/knockout mice) suggest that surfactant protein A1 (SPA1) interferes with EGF binding to EGFR in pulmonary alveoli cell lines; SPA1 directly binds extracellular domain of EGFR; binding of SPA1 to EGFR appears to be different from binding of SPD to EGFR; binding of SPA1 to EGFR does not suppress EGF-induced phosphorylation of EGFR or cell proliferation. PMID: 28972165 This review intends to provide a current overview of the genetics, structure and extra-pulmonary functions of the surfactant collectin proteins. PMID: 28351530 The SFTPA1 haplotype comprising rs17881720-A and rs17879335-G was a resistance factor while the haplotype comprising rs1914663-T and rs1059225-G was found to be a susceptibility factor to tuberculosis in Han Chinese population. PMID: 27012150 SP-A transiently enhances the basal protein expression of CHC and alpha-adaptin. PMID: 26771574 the presence of SP-A1 allows pulmonary surfactant to adopt a particularly favorable structure with optimal biophysical properties PMID: 27508436 SP-A1 6A4 and SP-A2 1A5 genetic variants may influence the susceptibility to respiratory distress syndrome in late-preterm infants, independently of the effect of other perinatal factors. PMID: 27835691 Direct interaction between SP-A or SAP01 and human BD-3 seemed to be responsible for the inhibitory effects on chemotaxis of mast cells. PMID: 28188794 SP-A (+186A/G) and SP-B (1580C/T) polymorphisms are strongly associated with the risk of respiratory distress syndrome (RDS) in preterm infants. Notably, reduced serum SP-A levels were correlated with a high risk of RDS and may serve as novel biomarkers for RDS detection and monitoring. PMID: 28011976 Surfactant protein A levels differed among idiopathic pulmonary fibrosis, pulmonary sarcoidosis and chronic pulmonary obstructive disease. PMID: 27758987 Differences were found regarding SPA and pro-SPB expression in the vast majority of subjects: in some lungs, SPA was more expressed whereas in others pro-SPB showed an higher degree of immunoreactivity. The expression of both surfactant proteins was not strictly correlated with gestational age. PMID: 27734990 Study identifies SFTPA1 as a gene involved in familial idiopathic interstitial pneumonia and shows that altered SP-A1 expression is associated with a large spectrum of phenotypic pulmonary manifestations ranging from severe respiratory insufficiency occurring early in life to lung fibrosis and cancer in adult patients. PMID: 26792177 These results suggested that the measurement of SPA levels in the exhaled breath condensate may serve as a method for monitoring airway obstruction in patients with chronic obstructive pulmonary disease. PMID: 26707652 Human and murine data together indicate that SP-A, SP-D and MBL are synthesized in early gestational tissues, and may contribute to regulation of immune response at the feto-maternal interface during pregnancy. PMID: 26603976 SP-A in exhaled particles from small airways may represent a promising non-invasive biomarker of disease in chronic obstructive pulmonary disease patients. PMID: 26656890 In this study, the loci and haplotypes associated with pulmonary tuberculosis (PTB)were found mostly to be located in the SFTPA2 gene, suggesting that the effects of the SFTPA2 gene on PTB are stronger than those of SFTPA1. PMID: 24984162 Data suggest that that surfactant protein A(SP-A) levels may be important to maintain surfactant function in the presence of high cholesterol within surfactant. PMID: 25522687 SP-A modulates lung immune system in the area of non-infectious lung diseases such as acute and chronic pulmonary fibrosis and lung cancer. PMID: 24705741 12 of which predicted to bind SP-A 3'UTRs. PMID: 25058539 This study shows that changes occur in the alveolar macrophage proteome in response to a single in vivo treatment with exogenous SP-A1 and/or SP-A2. PMID: 24954098 SP-A1 transcripts, which in turn negatively affect SP-A1 translation, possibly affecting SP-A1/SP-A2 ratio, with potential for clinical implication. PMID: 25326576 In this review, we highlight the associations of eosinophilic lung diseases with SP-A and SP-D levels and functions. PMID: 24960334 sequence variability at the 3'UTR of SFTPA1 and SFTPA2 gene variants differentially affects miRNA regulation of gene expression. PMID: 24793167 Results show that cloned surfactant-associated protein A (SPA) gene promoter had specific transcriptional activity in SPA high expression cells. PMID: 24939295 The result suggested that polymorphism of aa62 (CCA/CCG, rs1136451) of SP-A may be associated with the susceptibility to COPD in Xinjiang Uighurs. PMID: 22528218 The current meta-analysis indicates that common polymorphisms in the SP-A gene may contribute to increasing susceptibility to COPD, especially among Asian populations. PMID: 24093802 SP-A gene polymorphism is associated with kidney graft rejection. PMID: 24007361 SP-A inhibited lung cancer progression by recruiting and activating natural killer cells via controlling the polarization of tumor-associated macrophages. PMID: 23499372 The obtained results suggested that in vitro approach can be used to study pulmonary toxicity as long as the applied in vitro model mimics closely the complexity of in vivo situation. PMID: 22769972 Cat S may participate in the pathophysiology of cystic fibrosis by weakening the antibacterial activity of SP-A. PMID: 23707200 The aim of this report is to describe the genetic complexity of the SFTPA1 and SFTPA2 genes, as well as to review regulatory mechanisms that control SP-A expression in humans and other animal species.[review] PMID: 23069847 elevated expression in nasal mucosa in chronic rhinosinusitis with polyps PMID: 23406594 Surfactant Protein-A, like other host defense molecules in the reproductive tract, appears to be regulated by gonadal hormones. PMID: 22672628 Surfactant protein A associated with respiratory distress syndrome in Korean preterm infants: evidence of ethnic difference. PMID: 23038062 Lipoteichoic acid can increase SP-A synthesis in human alveolar type II epithelial cells through sequentially activating the MEK1-ERK1/2-NF-kappaB-dependent pathway PMID: 23031213 Gln238Lys missense variant of exon 6 in the SFTPA1 may have potential susceptibility in the development of IPF, which was shown in patients with sporadic IPF with a statistically higher frequency. PMID: 22884059 Surfactant protein-A suppresses eosinophil-mediated killing of Mycoplasma pneumoniae in allergic lungs PMID: 22384248 review focuses on published association studies of surfactant proteins A and D genetic polymorphisms with respiratory, and non-respiratory diseases in adults, children, and newborns [review] PMID: 22201752 SP-A protects lung epithelium from tissue injury caused by BD3 PMID: 22418431 Surfactant protein A is defective in abrogating inflammation in asthma. PMID: 21784968 genetic variants of the surfactant protein A1 confer a protective phenotype against severe acute respiratory syncytial infection PMID: 21601013 Both nasal polyps and nasal mucosa expressed SP-A mRNA and protein, but the expression was stronger in nasal polyps. PMID: 20873544 The expression of SP-A in allergic rhinitis and nasal polyps was dramatically higher than that in controls. PMID: 19894557 findings suggest that Suv39H1 and Suv39H2 are key hypoxia-induced methyltransferases; their decline in fetal lung during late gestation is critical for epigenetic changes resulting in the developmental induction of SP-A PMID: 21402781 Paucity of immunohistochemical SP-A expression in alveolar epithelial cells in diseased areas may predict a worse prognosis for patients with idiopathic interstitial pneumonias. PMID: 21435274 High SPA-1 is associated with invasion and metastasis of prostate cancer. PMID: 21251160 SP-A likely plays a critical role in regulating prostaglandin production within the uterus, culminating at term in decidual activation and the onset of labor. PMID: 21270323

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

📧 inquiry@betalifesci.com 📞 +1(201) 888-7983

Contact Us Now for Inquiries, Orders, and Questions

Recombinant Human Pulmonary Surfactant-Associated Protein A1 (SFTPA1) Protein (His)

Recombinant Human Pulmonary Surfactant-Associated Protein A1 (SFTPA1) Protein (His)

Product Overview

Target Details

FAQs