Recombinant Human Proto-Oncogene Wnt-1 (WNT1) Protein (His-GST&Myc)

Name: Recombinant Human Proto-Oncogene Wnt-1 (WNT1) Protein (His-GST&Myc)
Brand: Beta LifeScience
SKU: BLC-07093P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Product Overview

Description	Recombinant Human Proto-Oncogene Wnt-1 (WNT1) Protein (His-GST&Myc) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P04628
Target Symbol	WNT1
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-10His-GST&C-Myc
Target Protein Sequence	SCSEGSIESCTCDYRRRGPGGPDWHWGGCSDNIDFGRLFGREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTVRTCWMRLPTLRAVGDVLRDRFDGASRVLYGNRGSNRASRAELLRLEPEDPAHKPPSPHD
Expression Range	142-288aa
Protein Length	Partial
Mol. Weight	51.7 kDa
Research Area	Cancer
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Ligand for members of the frizzled family of seven transmembrane receptors. Acts in the canonical Wnt signaling pathway by promoting beta-catenin-dependent transcriptional activation. In some developmental processes, is also a ligand for the coreceptor RYK, thus triggering Wnt signaling. Plays an essential role in the development of the embryonic brain and central nervous system (CNS). Has a role in osteoblast function, bone development and bone homeostasis.
Subcellular Location	Secreted, extracellular space, extracellular matrix. Secreted.
Protein Families	Wnt family
Database References	HGNC: 12774 OMIM: 164820 KEGG: hsa:7471 STRING: 9606.ENSP00000293549 UniGene: Hs.248164
Associated Diseases	Osteoporosis (OSTEOP); Osteogenesis imperfecta 15 (OI15); Osteogenesis imperfecta 14 (OI14)

Gene Functions References

MiR301a increased the radiosensitivity and inhibited the migration of radioresistantESCC cells by targeting WNT1. PMID: 30365079
The WNT1 mutation disrupts feedback regulation between these miRNAs and WNT1, providing insights into the pathogenesis of WNT-related bone disorders. These miRNAs may have potential in the diagnosis and treatment of osteoporosis. PMID: 29506076
Taking together, these results suggest that Wnt/beta-catenin signal pathway activation-dependent up-regulation of syncytin-1 contributes to the pro-inflammatory factor TNF-alpha-enhanced fusion between oral squamous cell carcinoma cells and endothelial cells. PMID: 28112190
High WNT1 expression is associated with metastasis in cholangiocarcinoma. PMID: 30193944
We conclude that severe form of osteogenesis imperfecta (OI) may be associated with WNT1 mutation. This novel variant of WNT1 identified in achild with OI is likely cause for the disease. PMID: 29481978
MiR-185 inhibits colon cancer cell proliferation and invasion by targeting Wnt1. PMID: 29454608
High WNT1 expression is associated with epithelial-mesenchymal transition in gastric cancer. PMID: 29273006
Biallelic pathogenic splice acceptor site variant (c.359-3C>G) in WNT1 gene located on chromosome 12q13.12 underlying osteogenesis imperfecta type 3 in a Pakistani family. PMID: 28665926
Vertebral compression fractures were present in 78% (7/9) of those aged over 50years but were not seen in younger mutation-positive subjects. All those with fractures had several severely compressed vertebrae. Altogether spinal compression fractures were present in 39% of those with a WNT1 mutation. Only PMID: 28411110
miR-218 promoted the apoptosis of human ovarian carcinoma cells via suppression of the WNT/beta-catenin signaling pathway. PMID: 28900081
Data suggest that brain imaging be performed in any individual with WNT1-associated osteogenesis imperfecta (OI) who also has developmental delay or any neurological deficits. PMID: 26671912
Data indicate a tetracyclic azafluorenone, SJ26, that is capable of binding to G-quadruplex DNA structure, repressing WNT1 expression, and inhibiting cell migration. PMID: 27626678
Regulation of WNT signaling by VSX2 during optic vesicle patterning in human induced pluripotent stem cells has been described. PMID: 27301076
High WNT1 expression is associated with metastasis in triple-negative breast cancer. PMID: 26967387
WNT1 osteoporosis causes significant skeletal changes already in early childhood and impairs bone mass gain during pubertal years. PMID: 27005318
High WNT1 expression is associated with esophageal squamous cell carcinoma. PMID: 29054489
High WNT1 expression in stromal cells is associated with myelodysplastic syndrome. PMID: 28684528
High WNT1 expression is associated with gastric cancer. PMID: 28223537
Novel compound heterozygous WNT1 missense mutations, p.Glu123Asp and p.Cys153Gly, identified in a patient with osteogenesis imperfecta. PMID: 28528193
Osteocyte protein expression is altered in patients with osteoporosis caused by WNT1 mutation. PMID: 28379384
High WNT1 expression is associated with glioma cell invasion. PMID: 27006177
bone formation is under the control of WNT1 produced by osteocytes, the cells that reside deep in the bone matrix and form dendritic networks. PMID: 28628035
Knocking down of Wnt-1 by siRNA had the similar effect of miRNA-148a overexpression on cell migration and invasion in lung cancer cells. PMID: 28199399
High WNT1 expression is associated with Lung Adenocarcinoma Progression. PMID: 27197183
WNT1 overexpression is associated with Breast Cancer Invasion and Metastasis. PMID: 27197202
PKA signaling is pivotal in pigmentation process itself in cultured melanoma cells, while the importance of Wnt/beta-catenin signaling should be emphasized in the context of development and differentiation PMID: 27567978
Patients with WNT1 mutation-related osteoporosis respond to teriparatide treatment. PMID: 27732335
High WNT1 expression is associated with osteosarcoma. PMID: 27665868
These results suggest that alphaTAT1-mediated Wnt1 expression via microtubule acetylation is important for colon cancer progression. PMID: 27836544
Upregulation of WNT is associated with prostate cancer. PMID: 28098905
we introduced WNT1 gene as one of the important genes in Hepatocellular Carcinoma, and also, we showed that miR-122 can regulate WNT1 gene expression PMID: 27687586
Promoter hypermethylation of Wnt1 may play a crucial role in lung cancer carcinogenesis. PMID: 27930522
Overexpression of WNT1 is associated with hepatocellular carcinoma. PMID: 27465549
High WNT expression is associated with pancreatic cancer PMID: 27485116
The study expanded : Osteogenesis imperfecta (OI) spectrum and confirmed moderate to severe bone fragility induced by WNT1 defects. PMID: 27450065
Wnt1 expression was significantly higher in cutaneous squamous cell carcinoma samples than in the skin of control subjects. Wnt1 expression correlated with histopathological differentiation in cutaneous squamous cell carcinoma. PMID: 27420949
our results suggest that miR-148a can suppress the migration and invasion of breast cancer cells by targeting WNT-1 and inhibiting Wnt/beta-catenin signaling pathway and this will provide new insights into the molecular mechanisms of breast cancer metastasis PMID: 26707142
MCF7 cells over-expressing both WNT1 and FGF3 show a 3.5-fold increase in mammosphere formation; conditioned media from these cells also promotes stem cell activity in untransfected parental MCF7 and T47D cells, as WNT1 and FGF3 are secreted factors. PMID: 26421711
IWR-1 has the potential to suppress tumor metastasis by inhibiting Wnt/beta-catenin pathway as well as survivin expression PMID: 26450645
High expression of WNT1 is associated with liver cancer. PMID: 26499380
Studies indicate crosstalk between Notch receptor and Wnt protein, Hedgehog protein, hypoxia and transforming growth factor beta (TGFbeta)/bone morphogenetic protein (BMP) pathways. PMID: 26592459
Results suggested that Wnt1-induced MAFK expression promoted cell proliferation in MG63 cells, and that the role of MAFK in osteosarcoma might be closely linked to the Wnt signaling pathway. PMID: 26214410
Suggest that TGF-beta1/Smad and Wnt/CTNNB1 signaling pathways both contribute to pathological scar formation. PMID: 26261683
Data suggest that fibulin-5 functions as a metastasis suppressor in lung cancer by modulating tumor microenvironment to suppress Wnt/beta-catenin signaling. PMID: 25909283
Paracrine WNT signaling is stimulated by estrogen and progesterone, while autocrine WNT signaling is induced by the embryonic T-box transcription factor TBX3 PMID: 25350852
Wnt1 promotes CD36 expression via activation of PPAR-gamma and TCF4. PMID: 25721714
Agonists of epoxyeicosatrienoic acids reduce infarct size and ameliorate cardiac dysfunction via activation of HO-1 and Wnt1 canonical pathway. PMID: 25677507
WNT1 was a direct target of miR-148b, and overexpressed WNT1 inversely correlated with miR-148b levels in hepatocellular carcinoma tissues. PMID: 25627001
WNT/beta-catenin pathway and E-cadherin are important factors in advanced epithelial ovarian cancer. PMID: 24499657
Wnt1 stimulates osteogenic differentiation and mineralization of human periodontal ligament fibroblasts, mainly by activating the canonical Wnt/beta-catenin pathway, in which Runx2 is a key downstream regulator. PMID: 25618247

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.