Recombinant Human Proto-Oncogene C-Rel (REL) Protein (His)

Beta LifeScience SKU/CAT #: BLC-07970P
Greater than 85% as determined by SDS-PAGE.
Greater than 85% as determined by SDS-PAGE.

Recombinant Human Proto-Oncogene C-Rel (REL) Protein (His)

Beta LifeScience SKU/CAT #: BLC-07970P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Human Proto-Oncogene C-Rel (REL) Protein (His) is produced by our Yeast expression system. This is a protein fragment.
Purity Greater than 85% as determined by SDS-PAGE.
Uniprotkb Q04864
Target Symbol REL
Synonyms Avian reticuloendotheliosis ; C REL; C Rel protein; c Rel proto oncogene protein; Oncogene REL ; Oncogene REL avian reticuloendotheliosis; Proto-oncogene c-Rel; REL; REL_HUMAN; v rel avian reticuloendotheliosis viral oncogene homolog; v rel reticuloendotheliosis viral oncogene homolog ; V rel reticuloendotheliosis viral oncogene homolog (avian)
Species Homo sapiens (Human)
Expression System Yeast
Tag N-6His
Target Protein Sequence SGAYNPYIEIIEQPRQRGMRFRYKCEGRSAGSIPGEHSTDNNRTYPSIQIMNYYGKGKVRITLVTKNDPYKPHPHDLVGKDCRDGYYEAEFGQERRPLFFQNLGIRCVKKKEVKEAIITRIKAGINPFNVPEKQLNDIEDCDLNVVRLCFQVFLPDEHGNLTTALPPVVSNPIYDNRAPNTAELRICRVNKNCGSVRGGDEIFLLCDKVQKDDIEVRFVLNDWEAKGIFSQADVHRQVAIVFKTPPYCKAITEPVTVKMQLRRPSDQEVSESMDFRYLPDEKDTYGNKAKKQKTTLLFQKLCQDHVNFPERPRPGLLGSIGEGRYFKKEPNLFSHDAVVREMPTGVSSQAESYYPSPGPISSGLSHHASMAPLPSSSWSSVAHPTPRSGNTNPLSSFSTRTLPSNSQGIPPFLRIPVGNDLNASNACIYNNADDIVGMEASSMPSADLYGISDPNMLSNCSVNMMTTSSDSMGETDNPRLLSMNLENPSCNSVLDPRDLRQLHQMSSSSMSAGANSNTTVFVSQSDAFEGSDFSCADNSMINESGPSNSTNPNSHGFVQDSQYSGIGSMQNEQLSDSFPYEF
Expression Range 3-616aa
Protein Length Partial of Isoform 2
Mol. Weight 66.6 kDa
Research Area Transcription
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Proto-oncogene that may play a role in differentiation and lymphopoiesis. NF-kappa-B is a pleiotropic transcription factor which is present in almost all cell types and is involved in many biological processed such as inflammation, immunity, differentiation, cell growth, tumorigenesis and apoptosis. NF-kappa-B is a homo- or heterodimeric complex formed by the Rel-like domain-containing proteins RELA/p65, RELB, NFKB1/p105, NFKB1/p50, REL and NFKB2/p52. The dimers bind at kappa-B sites in the DNA of their target genes and the individual dimers have distinct preferences for different kappa-B sites that they can bind with distinguishable affinity and specificity. Different dimer combinations act as transcriptional activators or repressors, respectively. NF-kappa-B is controlled by various mechanisms of post-translational modification and subcellular compartmentalization as well as by interactions with other cofactors or corepressors. NF-kappa-B complexes are held in the cytoplasm in an inactive state complexed with members of the NF-kappa-B inhibitor (I-kappa-B) family. In a conventional activation pathway, I-kappa-B is phosphorylated by I-kappa-B kinases (IKKs) in response to different activators, subsequently degraded thus liberating the active NF-kappa-B complex which translocates to the nucleus. The NF-kappa-B heterodimer RELA/p65-c-Rel is a transcriptional activator.
Subcellular Location Nucleus.
Database References

HGNC: 9954

OMIM: 164910

KEGG: hsa:5966

STRING: 9606.ENSP00000295025

UniGene: PMID: 29336650

  • TAB1 was identified as a functional target of miR-134, and the expression of TAB1 was increased by the transcription factors of NF-kappaB1, c-Rel, and ELK1 via miR-134. PMID: 28206956
  • NOD2 up-regulates TLR2-mediated IL-23p19 expression via increasing c-Rel activation in Paneth cell-like cells PMID: 27563808
  • this study show that inhibition of c-Rel expression by siRNA reduced cord blood-derived B-, T-, and NK cell differentiation and expansion PMID: 28090796
  • Findings emphasize the importance of c-REL-signaling in a cellular model of cervical cancer particularly in terms of proliferation and resistance to chemotherapeutic agents. PMID: 28767691
  • genetic association studies in population in India: Data suggest that common polymorphisms (SNPs) in CHGA promoter are associated with cardiometabolic disorders; c-Rel has a role in activating CHGA promoter haplotype 2 (variant T alleles at -1018 and -57 bp) under basal and pathophysiological conditions. (CHGA = chromogranin A; c-Rel = c-Rel proto-oncogene protein) PMID: 28667172
  • findings suggest that c-Rel might play a role in promoting the invasion of choriocarcinoma cells through PI3K/AKT signaling PMID: 28259870
  • miR-574 and REL interfere with apoptosis in prostate cancer stem cells. PMID: 27779701
  • observations indicate that induced expression of miR-15b is modulated by c-Rel and CREB in response to JEV infection PMID: 26931521
  • Gene expression levels of Rel were deregulated in 49 B-cell chronic lymphocytic leukemia, 8 B-cell non-Hodgkin's lymphoma, 3 acute myeloid leukemia, 3 chronic myeloid leukemia, 2 hairy cell leukemia, 2 myelodysplastic syndrome, and 2 T-cell large granular lymphocytic leukemia patients in the post-Chernobyl period. PMID: 25912249
  • The REL rs842647 polymorphism may be a susceptibility factor for Behcet's Disease pathogenesis and skin lesions. PMID: 26784953
  • analysis of c-Rel nuclear expression and REL amplification and crosstalk between c-Rel and the p53 pathway reveals prognostic roles diffuse large B-cell lymphoma PMID: 26324762
  • Over-expression of nuclear NF-kappaB1 and c-Rel are strong risk factors associated with chemoresistance and the prognosis of serous epithelial ovarian cancer PMID: 26683819
  • Thus, our studies support a role for c-Rel in processes crucial for keratinocyte integrity and malignant transformation such as adhesion and migration. PMID: 25842167
  • c-Rel is a critical mediator of NF-kappaB-dependent TRAIL resistance of pancreatic cancer cells. PMID: 25299780
  • c-Rel regulates Ezh2 expression in lymphocytes and malignant lymphoid cells in a novel transcriptional network PMID: 25266721
  • The REL SNP rs9309331 homozygous minor allele was associated with higher LDL levels in rheumatoid arthritis. PMID: 24489016
  • Data indicate that the NF-kappaB subunit c-Rel is modified and activated by O-GlcNAcylation. PMID: 23982206
  • Our studies indicate that c-Rel is a key regulator of cell fate decisions in keratinocytes such as cell growth and death and may have a role in epidermal carcinogenesis. PMID: 23892589
  • The findings confirm the association of early-onset psoriasis with REL (rs13031237). PMID: 23106574
  • a genetic increase in the activity of the NF-kappaB subunit c-Rel results in protection against cell death in human islets--nuclear factor-kappaB subunit c-Rel. PMID: 19706790
  • Activation of NF-kappaB p65 and c-Rel may be considered an important regulator of hypersplenism and liver cirrhosis. PMID: 23195252
  • REL polymorphisms lack association with rheumatoid arthritis in the Tunisian population. PMID: 22459418
  • UCP4 is a target effector gene of the NF-kappaB c-Rel prosurvival pathway to mitigate the effects of oxidative stress. PMID: 22580300
  • Kidney allografts from clinical operational tolerance patients show significant cellular infiltrates but a distinct expression of proteins involved in the NFkappaB1/c-rel pathway. PMID: 22955189
  • c-Rel, as a member of the Rel/NF-kappaB family, is associated with psoriatic arthritis. PMID: 22170493
  • IRF-4 was shown to enhance the c-Rel-dependent binding and activation of the interleukin-4 (IL-4) promoter region. IL-2 production was also enhanced by exogenously-expressed IRF-4 and c-Rel. PMID: 21890374
  • Nuclear factor kappaB subunits RelB and cRel negatively regulate Toll-like receptor 3-mediated beta-interferon production via induction of transcriptional repressor protein YY1. PMID: 22065573
  • Levels of c-Rel directly modulated expression of caspase-4 as well as other endoplasmic reticulum stress genes. PMID: 21984918
  • By a novel, reversible dynamic mechanism TNF-alpha-induced c-REL/DeltaNp63alpha interactions inactivate tumor suppressor TAp73 function, promoting TNF-alpha resistance & cell survival in cancers with mtTP53. PMID: 21933882
  • TAK1-c-Rel and IRF4 pathways play distinct roles in the maintenance of IL-9-producing Th17 phenotype of HTLV-1-transformed cells PMID: 21498517
  • Three ulcerative colitis susceptibility loci are associated with primary sclerosing cholangitis and indicate a role for IL2, REL, and CARD9. PMID: 21425313
  • Data show that Foxp3 directly or as part of a multimeric complex engages with the NF-kappaB component c-Rel. PMID: 21490927
  • IL-23 induction by beta-glucans is due to activation of c-Rel associated with Ser-10-histone H3 phosphorylation in the il23a promoter mediated by MAPK and SAPK or PKA, and inhibition of il12a transcription PMID: 21402701
  • Thus, dectin-1 and dectin-2 control adaptive T(H)-17 immunity to fungi via Malt1-dependent activation of c-Rel. PMID: 21283787
  • the described effect of REL rs13031237 on the predisposition for rheumatoid arthritis was re-evaluated in a large case-control data set of 23 711 individuals and showed a modest increase in rheumatoid arthritis risk. PMID: 20876593
  • Three new susceptibility loci at 2p16.1 (rs1432295, REL, 8q24.21 (rs2019960, PVT1 and 10p14 (rs501764, GATA3). PMID: 21037568
  • CXCR2 signaling is critical in transgenic mice with C-rel-deficient/NFkappaB1-deficient/heterozygous Rela+/- neutrophilia causing spontaneous inflammation. PMID: 20519647
  • The REL locus is associated with rheumatoid arthritis susceptibility in the UK population PMID: 19945995
  • characterize the prevalence of REL, BCL11A, and MYCN gains in a consecutive CLL series at the time of diagnosis; (ii) define the prognostic relevance of REL, BCL11A, and MYCN gains in CLL. PMID: 20575024
  • c-Rel, but not nuclear factor-kappa B1 (NFKB1), is required for development of transgenic regulatory T cell progenitors. PMID: 20228198
  • The kinetics of NFkappaB subunit activation are partly responsible for the observed pattern of acute inflammation in the adenoviral-infected cornea. PMID: 20038977
  • REL rather than BCL11A may be the target of the 2p13 alterations in classical Hodgkin Lymphoma. PMID: 11830502
  • REL has an important pathologic role in Hodgkin's lymphoma PMID: 12478664
  • The correlation of structural aberrations of the REL locus & nuclear c-Rel accumulation in Reed-Sternberg cells qualifies REL as a target gene of the frequent gains in 2p in cHL. REL aberrations contribute to constitutive NF-kappa B/Rel activation in cHL. PMID: 12511414
  • calmodulin binds c-Rel and RelA after their release from I kappa B and can inhibit nuclear import of c-Rel while letting RelA translocate to the nucleus and act on its target genes PMID: 12556500
  • v-REL has a role in NF-kappaB-regulated cell death PMID: 12588973
  • Deletion of either C-terminal transactivation subdomains enhances the in viitro transforming activity of REL in chicken spleen cells. PMID: 14534540
  • REL amplification may not be causative in diffuse large B-cell lymphoma PMID: 14615382
  • Rel/NF-kappaB factors could take part in the occurrence of senescence by generating an oxidative stress. PMID: 14744759
  • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    Recently viewed